ABCD1 Recombinant monoclonal antibody, PBS Only (Detector)

ABCD1 Uni-rAb® Recombinant Antibody for Cytometric bead array, Sandwich ELISA, Indirect ELISA
Cat No. 83038-3-PBS
Clone No.230226G11

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Cytometric bead array, Sandwich ELISA, Indirect ELISA

ABCD 1, ALD, ATP binding cassette sub family D member 1, ATP-binding cassette sub-family D member 1, EC:3.1.2.-

Formulation:  PBS Only
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

83038-3-PBS targets ABCD1 as part of a matched antibody pair:

MP00070-1: 83038-1-PBS capture and 83038-3-PBS detection (validated in Cytometric bead array, Sandwich ELISA)

MP00070-2: 83038-2-PBS capture and 83038-3-PBS detection (validated in Cytometric bead array, Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag0453

Product name: Recombinant human ABCD1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 334-507 aa of BC025358

Sequence: LMKYVWSASGLLMVAVPIITATGYSESDAEAVKKAALEKKEEELVSERTEAFTIARNLLTAAADAIERIMSSYKEVTELAGYTARVHEMFQVFEDVQRCHFKRPRELEDAQAGSGTIGRSGVRVEGPLKIRGQVVDVEQGIICENIPIVTPSGEVVVASLNIRVEEGMHLLITG

Predict reactive species
Full Name ATP-binding cassette, sub-family D (ALD), member 1
Calculated Molecular Weight 745 aa, 83 kDa
GenBank Accession NumberBC025358
Gene Symbol ABCD1
Gene ID (NCBI) 215
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP33897
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.
Loading...
||
New chat Able
正在加载,请稍候...