Home
Products
Primary Antibodies
Recombinant Antibodies
SOX2 Recombinant monoclonal antibody, PBS Only (Capture) (83059-6-PBS)

SOX2 Recombinant monoclonal antibody, PBS Only (Capture)

Name: SOX2 Recombinant monoclonal antibody, PBS Only (Capture), 100ug
Brand: Proteintech
SKU: 83059-6-PBS-100UG

SOX2 Uni-rAb^® Recombinant Antibody for WB, Sandwich ELISA, Indirect ELISA

Cat No. 83059-6-PBS

Clone No.252889F12

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Sandwich ELISA, Indirect ELISA

Synonyms

ANOP3, MCOPS 3, MCOPS3, SOX 2, Transcription factor SOX 2

Formulation: PBS Only

PBS, Azide, Glycerol

PBS Only

Conjugate: Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllWBSandwich ELISA sample testSandwich ELISA

WB analysis using 83059-6-RR (same clone as 83059-6-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 83059-6-RR (SOX2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 83059-6-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis using 83059-6-RR (same clone as 83059-6-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 83059-6-RR (SOX2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 83059-6-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
Sandwich ELISA sample test of MP00077-3
The mean SOX2 concentration was determined to be 36.70 ng/mL in NCCIT cell extract based on a 1.10 mg/mL extract load, 54.00 ng/mL in U-251 cell extract based on a 1.20 mg/mL extract load, 66.90 ng/mL in HEK-293 cell extract based on a 1.20 mg/mL extract load, 45.50 ng/mL in SKOV-3 cell extract based on a 1.20 mg/mL extract load and 51.10 ng/mL in Raji cell extract based on a 1.20 mg/mL extract load.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
×
The mean SOX2 concentration was determined to be 36.70 ng/mL in NCCIT cell extract based on a 1.10 mg/mL extract load, 54.00 ng/mL in U-251 cell extract based on a 1.20 mg/mL extract load, 66.90 ng/mL in HEK-293 cell extract based on a 1.20 mg/mL extract load, 45.50 ng/mL in SKOV-3 cell extract based on a 1.20 mg/mL extract load and 51.10 ng/mL in Raji cell extract based on a 1.20 mg/mL extract load.
Sandwich ELISA sample test of MP00077-3
Plasma of eight individual healthy human donors was measured. The SOX2 concentration of detected samples was determined to be 6.79 ng/mL with a range of 3.51-10.60 ng/mL.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
Sandwich ELISA standard curve of MP00077-3
Sandwich ELISA standard curve of MP00077-3, Human SOX2 Recombinant Matched Antibody Pair - PBS only. 83059-6-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Ag0612. 83059-9-PBS was HRP conjugated as the detection antibody. Range: 1.56-50 ng/mL.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

83059-6-PBS targets SOX2 as part of a matched antibody pair:

MP00077-3: 83059-6-PBS capture and 83059-9-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity	human, mouse, rat
Host / Isotype	Rabbit / IgG
Class	Recombinant
Type	Antibody
Immunogen	CatNo: Ag0612 Product name: Recombinant human SOX2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 59-118 aa of BC013923 Sequence: MAQENPKMHNSEISKRLGAEWKLLSETEKRPFIDEAKRLRALHMKEHPDYKYRPRRKTKT Predict reactive species
Full Name	SRY (sex determining region Y)-box 2
Calculated Molecular Weight	34 kDa
Observed Molecular Weight	34-43 kDa
GenBank Accession Number	BC013923
Gene Symbol	SOX2
Gene ID (NCBI)	6657
RRID	AB_3743460
Conjugate	Unconjugated
Form	Liquid
Purification Method	Protein A purification
UNIPROT ID	P48431
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

Sox2, also known as SRY (sex determining region Y)-box 2, is a transcription factor essential for maintaining self-renewal of undifferentiated ES cells and is one of the key transcription factors used to reprogram mouse and human fibroblasts to a pluripotent state. Sox2 expressed in undifferentiated pluripotent stem cells and germ cells during development. A rare undiferentiated cell population that is intermingled with the Bergmann glia of the adult murine cerebellar cortex, expresses the stem cell markers Sox2 and Nestin, and lacks markers of glial or neuronal diferentiation.