Tested Applications
| Positive WB detected in | HEK-293 cells, NIH/3T3 cells, mouse testis tissue, mouse brain tissue |
| Positive IF/ICC detected in | MCF-7 cells |
| Positive FC (Intra) detected in | A431 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
83100-1-RR targets PCYT1A in WB, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | rat |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag34268 Product name: Recombinant human PCYT1A protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-76 aa of NM_005017 Sequence: MDAQCSAKVNARKRRKEAPGPNGATEEDGVPSKVQRCAVGLRQPAPFSDEIEVDFSKPYVRVTMEEASRGTPCERP Predict reactive species |
| Full Name | phosphate cytidylyltransferase 1, choline, alpha |
| Calculated Molecular Weight | 42 kDa |
| Observed Molecular Weight | 38-41 kDa |
| GenBank Accession Number | NM_005017 |
| Gene Symbol | PCYT1A |
| Gene ID (NCBI) | 5130 |
| RRID | AB_3670813 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P49585 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for PCYT1A antibody 83100-1-RR | Download protocol |
| WB protocol for PCYT1A antibody 83100-1-RR | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The PCYT1A Recombinant monoclonal antibody (230393B4), catalog number 83100-1-RR, has 1 total citation. It appears in the journal Cell Signaling (2025). The associated research field is the molecular mechanism of KPNA2 regulation of myocardial ischemia/delayed reperfusion injury through mitophagy, involving cardiac and mitochondrial biology.
| Species | Application | Title |
|---|---|---|
Cell Signal Study on the molecular mechanism of KPNA2 regulation of myocardial ischemia/delayed reperfusion injury through mitophagy. |
Reviews
What customers say
The single review for this product is highly positive, rated 5 stars. The reviewer used it for Western Blot on mouse liver tissue at a 1:10,000 dilution and reported a very strong signal with a clean background, describing it as a great antibody. Overall, the feedback highlights excellent performance and reliable results in WB applications.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Hua (Verified Customer) (08-30-2024) | Great antibody. Very strong signal and clean background.
 |
