Product Information
83100-1-PBS targets PCYT1A in WB, IF/ICC, FC (Intra), Indirect ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag34268 Product name: Recombinant human PCYT1A protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-76 aa of NM_005017 Sequence: MDAQCSAKVNARKRRKEAPGPNGATEEDGVPSKVQRCAVGLRQPAPFSDEIEVDFSKPYVRVTMEEASRGTPCERP Predict reactive species |
| Full Name | phosphate cytidylyltransferase 1, choline, alpha |
| Calculated Molecular Weight | 42 kDa |
| Observed Molecular Weight | 38-41 kDa |
| GenBank Accession Number | NM_005017 |
| Gene Symbol | PCYT1A |
| Gene ID (NCBI) | 5130 |
| RRID | AB_3670813 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P49585 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |









