NEDD4 Recombinant monoclonal antibody

NEDD4 Uni-rAb® Recombinant Antibody for WB, IF/ICC, FC (Intra), ELISA
Cat No. 83112-4-RR
Clone No.230478D8

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, FC (Intra), ELISA

230478D8, Cell proliferation-inducing gene 53 protein, E3 ubiquitin-protein ligase NEDD4, EC:2.3.2.26, HECT-type E3 ubiquitin transferase NEDD4

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inC6 cells, A549 cells, Jurkat cells, NIH/3T3 cells
Positive IF/ICC detected inU2OS cells
Positive FC (Intra) detected inU2OS cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunofluorescence (IF)/ICCIF/ICC : 1:125-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

83112-4-RR targets NEDD4 in WB, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag16291

Product name: Recombinant human NEDD4 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 970-1319 aa of BC152452

Sequence: TVLEDSYRRIMGVKRADFLKARLWIEFDGEKGLDYGGVAREWFFLISKEMFNPYYGLFEYSATDNYTLQINPNSGLCNEDHLSYFKFIGRVAGMAVYHGKLLDGFFIRPFYKMMLHKPITLHDMESVDSEYYNSLRWILENDPTELDLRFIIDEELFGQTHQHELKNGGSEIVVTNKNKKEYIYLVIQWRFVNRIQKQMAAFKEGFFELIPQDLIKIFDENELELLMCGLGDVDVNDWREHTKYKNGYSANHQVIQWFWKAVLMMDSEKRIRLLQFVTGTSRVPMNGFAELYGSNGPQSFTVEQWGTPEKLPRAHTCFNRLDLPPYESFEELWDKLQMAIENTQGFDGVD

Predict reactive species
Full Name neural precursor cell expressed, developmentally down-regulated 4
Calculated Molecular Weight 1319 aa, 149 kDa
Observed Molecular Weight 115 kDa
GenBank Accession NumberBC152452
Gene Symbol NEDD4
Gene ID (NCBI) 4734
RRIDAB_3670824
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP46934
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

NEDD4 and similar proteins discovered subsequently became a family of HECT ligases, comprising 9 human proteins including NEDD4, NEDD4-2 (NEDD4L), ITCH, SMURF1, SMURF2, WWP1, WWP2, NEDL1 and NEDL2. NEDD4 is a highly evolutionarily conserved protein from yeast to man, and was initially cloned as a highly expressed gene in the early embryonic brain. NEDD4 is frequently overexpressed in many different types of cancer, and decreased levels of NEDD4 can also be associated with cancer. It can be a potential therapeutic target for the treatment of human cancer.(PMID: 25527121). The human NEDD4 gene is located on chromosome 15q21.3 and comprises 30 exons (HGNC:7727) shown to encode a ~120 KDa protein. Otherwise there is a 75 kDa isoform in addition to full length NEDD4 (PMID: 24907641).

Protocols

Product Specific Protocols
IF protocol for NEDD4 antibody 83112-4-RRDownload protocol
WB protocol for NEDD4 antibody 83112-4-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...