SLC25A46 Recombinant monoclonal antibody

SLC25A46 Uni-rAb® Recombinant Antibody for WB, FC (Intra), ELISA
Cat No. 83360-2-RR
Clone No.240114G3

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, FC (Intra), ELISA

240114G3, Mitochondrial outer membrane protein SLC25A46, TB1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHEK-293 cells, HepG2 cells, MCF-7 cells, HeLa cells, Jurkat cells, MDA-MB-231 cells, mouse brain tissue
Positive FC (Intra) detected inCaco-2 cells, HeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

83360-2-RR targets SLC25A46 in WB, FC (Intra), ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag27293

Product name: Recombinant human SLC25A46 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 222-382 aa of BC017169

Sequence: IETVQSEIIRDNTGILECVKEGIGRVIGMGVPHSKRLLPLLSLIFPTVLHGVLHYIISSVIQKFVLLILKRKTYNSHLAESTSPVQSMLDAYFPELIANFAASLCSDVILYPLETVLHRLHIQGTRTIIDNTDLGYEVLPINTQYEGMRDCINTIRQEEGV

Predict reactive species
Full Name solute carrier family 25, member 46
Calculated Molecular Weight 418 aa, 46 kDa
Observed Molecular Weight 46 kDa
GenBank Accession NumberBC017169
Gene Symbol SLC25A46
Gene ID (NCBI) 91137
RRIDAB_3671014
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ96AG3
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Solute carrier family 25 member 46 (SLC25A46), a highly conserved protein among various species including vertebrates, is a nuclear gene encoding mitochondrial carriers. SLC25A46 is involved in mitochondrial fission and the transport of lipids from the endoplasmic reticulum to mitochondria (PMID: 33277645). SLC25A46 has 3 isoforms with molecular weights of 30, 37 and 46 kDa, respectively.

Protocols

Product Specific Protocols
FC protocol for SLC25A46 antibody 83360-2-RRDownload protocol
WB protocol for SLC25A46 antibody 83360-2-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...