NCOA4 Recombinant monoclonal antibody

NCOA4 Uni-rAb® Recombinant Antibody for WB, IF/ICC, FC (Intra), ELISA
Cat No. 83394-4-RR
Clone No.240169H7

Host / Isotype

Rabbit / IgG

Reactivity

human and More (2)

Applications

WB, IF/ICC, FC (Intra), ELISA

ELE1, ARA70, Androgen receptor-associated protein of 70 kDa, 70 kDa AR-activator, 70 kDa AR activator

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inPC-3 cells, HepG2 cells, MCF-7 cells, DU 145 cells
Positive IF/ICC detected inHepG2 cells
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
Immunofluorescence (IF)/ICCIF/ICC : 1:150-1:600
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

83394-4-RR targets NCOA4 in WB, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivitybovine, sheep
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag15277

Product name: Recombinant human NCOA4 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-400 aa of BC012736

Sequence: MNTFQDQSGSSSNREPLLRCSDARRDLELAIGGVLRAEQQIKDNLREVKAQIHSCISRHLECLRSREVWLYEQVDLIYQLKEETLQQQAQQLYSLLGQFNCLTHQLECTQNKDLANQVSVCLERLGSLTLKPEDSTVLLFEADTITLRQTITTFGSLKTIQIPEHLMAHASSANIGPFLEKRGCISMPEQKSASGIVAVPFSEWLLGSKPASGYQAPYIPSTDPQDWLTQKQTLENSQTSSRACNFFNNVGGNLKGLENWLLKSEKSSYQKCNSHSTTSSFSIEMEKVGDQELPDQDEMDLSDWLVTPQESHKLRKPENGSRETSEKFKLLFQSYNVNDWLVKTDSCTNCQGNQPKGVEIENLGNLKCLNDHLEAKKPLSTPSMVTEDWLVQNHQDPCKV

Predict reactive species
Full Name nuclear receptor coactivator 4
Calculated Molecular Weight 70 kDa
Observed Molecular Weight70-73 kDa
GenBank Accession NumberBC012736
Gene Symbol NCOA4
Gene ID (NCBI) 8031
RRIDAB_3671047
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ13772
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Nuclear receptor coactivator 4 (NCOA4) also named androgen receptor (AR) coactivator ARA70, RFG and ELE1, is a putative co-activator that specifically enhances the activity of the androgen receptor. In human thyroid carcinomas, the Ret proto-oncogene fuses to ARA70 to form Ret/PTC3 by an intrachromosomal inversion of chromosome 10 in vivo. ARA70a can function as a ligand-enhanced co-activator of PPARg in adipocytes. However, PPARg-ARA70 transactivation can be squelched by AR, which suggests cross talk between PPARg- and AR-mediated response. ARA70a has no intrinsic transcription activation domain or histone acetyltransferase activity, but it interacts with histone acetyltransferase, p/CAF, CBP and p300/CBP-associated factors, and the basal transcription factor TFIIB. The interaction between ARA70 and AR occurs through the ligand-binding domain. The presence of ARA70 can enhance the androgenic activity of 17-b Estradiol (E2) and antiandrogens toward AR. ARA70 may be involved in prostate carcinogenesis and ovarian cancer and may serve as a key mediator of estrogen-androgen synergism.

Protocols

Product Specific Protocols
FC protocol for NCOA4 antibody 83394-4-RRDownload protocol
IF protocol for NCOA4 antibody 83394-4-RRDownload protocol
WB protocol for NCOA4 antibody 83394-4-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
sheepWB

J Dairy Sci

Short-term effects of Subacute ruminal acidosis on ferroptosis and iron metabolism in the livers of lactating sheep fed a high-grain diet

Authors - Hongzhu Zhang
bovineWB,IF

Redox Biol

Quercetin alleviates LPS/iE-DAP-induced liver injury by suppressing ferroptosis via regulating ferritinophagy and intracellular iron efflux

Authors - Hongzhu Zhang
  • KD Validated
Loading...
||
New chat Able
正在加载,请稍候...