CoraLite® Plus 488-conjugated NCOA4 Recombinant monoclonal antibody

NCOA4 Uni-rAb® Recombinant Antibody for IF/ICC
Cat No. CL488-83394-4
Clone No.240169H7

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC

ELE1, ARA70, Androgen receptor-associated protein of 70 kDa, 70 kDa AR-activator, 70 kDa AR activator

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-83394-4 targets NCOA4 in IF/ICC applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag15277

Product name: Recombinant human NCOA4 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-400 aa of BC012736

Sequence: MNTFQDQSGSSSNREPLLRCSDARRDLELAIGGVLRAEQQIKDNLREVKAQIHSCISRHLECLRSREVWLYEQVDLIYQLKEETLQQQAQQLYSLLGQFNCLTHQLECTQNKDLANQVSVCLERLGSLTLKPEDSTVLLFEADTITLRQTITTFGSLKTIQIPEHLMAHASSANIGPFLEKRGCISMPEQKSASGIVAVPFSEWLLGSKPASGYQAPYIPSTDPQDWLTQKQTLENSQTSSRACNFFNNVGGNLKGLENWLLKSEKSSYQKCNSHSTTSSFSIEMEKVGDQELPDQDEMDLSDWLVTPQESHKLRKPENGSRETSEKFKLLFQSYNVNDWLVKTDSCTNCQGNQPKGVEIENLGNLKCLNDHLEAKKPLSTPSMVTEDWLVQNHQDPCKV

Predict reactive species
Full Name nuclear receptor coactivator 4
Calculated Molecular Weight 70 kDa
Observed Molecular Weight70-73 kDa
GenBank Accession NumberBC012736
Gene Symbol NCOA4
Gene ID (NCBI) 8031
RRIDAB_3673247
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ13772
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Nuclear receptor coactivator 4 (NCOA4) also named androgen receptor (AR) coactivator ARA70, RFG and ELE1, is a putative co-activator that specifically enhances the activity of the androgen receptor. In human thyroid carcinomas, the Ret proto-oncogene fuses to ARA70 to form Ret/PTC3 by an intrachromosomal inversion of chromosome 10 in vivo. ARA70a can function as a ligand-enhanced co-activator of PPARg in adipocytes. However, PPARg-ARA70 transactivation can be squelched by AR, which suggests cross talk between PPARg- and AR-mediated response. ARA70a has no intrinsic transcription activation domain or histone acetyltransferase activity, but it interacts with histone acetyltransferase, p/CAF, CBP and p300/CBP-associated factors, and the basal transcription factor TFIIB. The interaction between ARA70 and AR occurs through the ligand-binding domain. The presence of ARA70 can enhance the androgenic activity of 17-b Estradiol (E2) and antiandrogens toward AR. ARA70 may be involved in prostate carcinogenesis and ovarian cancer and may serve as a key mediator of estrogen-androgen synergism.

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 NCOA4 antibody CL488-83394-4Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...