CoraLite® Plus 647-conjugated TMEM119 Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• CoraLite® Plus 647-conjugated TMEM119 Recombinant monoclonal antibody (CL647-83448-9)

TMEM119 Uni-rAb^® Recombinant Antibody for IF-P

Cat No. CL647-83448-9

Clone No.251557E2

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IF-P

Synonyms

OBIF, Osteoblast induction factor, transmembrane protein 119, UNQ731/PRO1415

• 

  IF Staining of mouse brain using CL647-83448-9

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse brain tissue using CoraLite® Plus 647 TMEM119 antibody (CL647-83448-9, Clone: 251557E2 ) at dilution of 1:200. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive IF-P detected in: mouse brain tissue

Recommended dilution

• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL647-83448-9 targets TMEM119 in IF-P applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg1823

  Product name: Recombinant human TMEM119 protein

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 26-96 aa of NM_181724

  Sequence: RSVPLKATFLEDVAGSGEAEGSSASSPSLPPPWTPALSPTSMGPQPITLGGPSPPTNFLDGIVDFFRQYVM

• Full Name: transmembrane protein 119
• Calculated Molecular Weight: 29 kDa
• GenBank Accession Number: NM_181724
• Gene Symbol: TMEM119
• Gene ID (NCBI): 338773
• Conjugate: CoraLite® Plus 647 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 654 nm / 674 nm
• Excitation Laser: Red Laser (633 nm)
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q4V9L6
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

Transmembrane protein 119 (TMEM119), was characterized to be a specific microglia marker by Bennet et al. in 2016, although its function in microglia remains unknown. It is considered to be a marker expressed by microglia under homeostatic conditions based on transcriptomic findings . Under pathological conditions, the immune-specialized brain microenvironment contains both resident microglia and bone marrow-derived myeloid cells recruited from peripheral circulation. Recently, transmembrane protein 119 (TMEM119) has been reported as a marker for resident microglia which is not expressed by bone marrow-derived myeloid cells. (PMID: 35247551, PMID: 38308250, PMID: 40373772)