Filter:
Tested Applications
| Positive WB detected in | PC-3 cells, HEK-293 cells |
| Positive FC (Intra) detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:10000 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
83473-3-RR targets FAM116A in WB, FC (Intra), ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag22052 Product name: Recombinant human FAM116A protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-60 aa of BC040291 Sequence: MALRGPAGLGPGSRRPLDEAVAGAEGREAPALVAAGGAPEDDEEDDGRGRGLLRWDSFSA Predict reactive species |
| Full Name | family with sequence similarity 116, member A |
| Calculated Molecular Weight | 608 aa, 70 kDa |
| Observed Molecular Weight | 61 kDa |
| GenBank Accession Number | BC040291 |
| Gene Symbol | FAM116A |
| Gene ID (NCBI) | 201627 |
| RRID | AB_3671102 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q8IWF6 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
FAM116A has DENN-related domains, which are required for cell migration.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for FAM116A antibody 83473-3-RR | Download protocol |
| WB protocol for FAM116A antibody 83473-3-RR | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
