FOXC2 Recombinant monoclonal antibody

FOXC2 Uni-rAb® Recombinant Antibody for WB, FC (Intra), ELISA
Cat No. 83476-6-RR
Clone No.240403A2

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, FC (Intra), ELISA

MFH 1, Mesenchyme fork head protein 1, Forkhead-related protein FKHL14, Forkhead box protein C2, FKHL14

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA549 cells, A 375 cells, HCT 116 cells, MCF-7 cells, HepG2 cells, MDA-MB-453 cells, SW480 cells
Positive FC (Intra) detected inA549 cells, HeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

83476-6-RR targets FOXC2 in WB, FC (Intra), ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag33121

Product name: Recombinant human FOXC2 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 205-501 aa of NM_005251

Sequence: KEAEKKVVIKSEAASPALPVITKVETLSPESALQGSPRSAASTPAGSPDGSLPEHHAAAPNGLPGFSVENIMTLRTSPPGGELSPGAGRAGLVVPPLALPYAAAPPAAYGQPCAQGLEAGAAGGYQCSMRAMSLYTGAERPAHMCVPPALDEALSDHPSGPTSPLSALNLAAGQEGALAATGHHHQHHGHHHPQAPPPPPAPQPQPTPQPGAAAAQAASWYLNHSGDLNHLPGHTFAAQQQTFPNVREMFNSHRLGIENSTLGESQVSGNASCQLPYRSTPPLYRHAAPYSYDCTKY*

Predict reactive species
Full Name forkhead box C2 (MFH-1, mesenchyme forkhead 1)
Calculated Molecular Weight54kd
Observed Molecular Weight 54-68 kDa
GenBank Accession NumberNM_005251
Gene Symbol FOXC2
Gene ID (NCBI) 2303
RRIDAB_3671105
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purfication
UNIPROT IDQ99958
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Forkhead box protein C2 (FOXC2) also known as forkhead-related protein FKHL14 (FKHL14), transcription factor FKH-14, or mesenchyme fork head protein 1 (MFH1) is a protein that in humans is encoded by the FOXC2 gene. FOXC2 is a member of the fork head box (FOX) family of transcription factors. FOX transcription factors are expressed during development and are associated with a number of cellular and developmental differentiation processes. FOXC2 is required during early development of the kidneys, including differentiation of podocytes and maturation of the glomerular basement membrane. It is also involved in the early development of the heart. FOXC2 is also involved in cancer metastases. In particular, expression of FOXC2 is induced when epithelial cells undergo an epithelial-mesenchymal transition (EMT) and become mesenchymal looking cells. (PMID: 8674414 9169153 19935708) This antibody recognizes the 56 kDa FOXC2 protein, but the phosphorylated FOXC2 may be a 56-65 kDa protein. The 62kDa band was also detected in the study(PMID: 19540201).

Protocols

Product Specific Protocols
WB protocol for FOXC2 antibody 83476-6-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...