FOXC2 Recombinant monoclonal antibody, PBS Only

FOXC2 Uni-rAb® Recombinant Antibody for WB, FC (Intra), Indirect ELISA

Cat No. 83476-6-PBS
Clone No.240403A2

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, FC (Intra), Indirect ELISA

MFH 1, Mesenchyme fork head protein 1, Forkhead-related protein FKHL14, Forkhead box protein C2, FKHL14

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

83476-6-PBS targets FOXC2 in WB, FC (Intra), Indirect ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag33121

Product name: Recombinant human FOXC2 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 205-501 aa of NM_005251

Sequence: KEAEKKVVIKSEAASPALPVITKVETLSPESALQGSPRSAASTPAGSPDGSLPEHHAAAPNGLPGFSVENIMTLRTSPPGGELSPGAGRAGLVVPPLALPYAAAPPAAYGQPCAQGLEAGAAGGYQCSMRAMSLYTGAERPAHMCVPPALDEALSDHPSGPTSPLSALNLAAGQEGALAATGHHHQHHGHHHPQAPPPPPAPQPQPTPQPGAAAAQAASWYLNHSGDLNHLPGHTFAAQQQTFPNVREMFNSHRLGIENSTLGESQVSGNASCQLPYRSTPPLYRHAAPYSYDCTKY*

Predict reactive species
Full Name forkhead box C2 (MFH-1, mesenchyme forkhead 1)
Calculated Molecular Weight54kd
Observed Molecular Weight 54-68 kDa
GenBank Accession NumberNM_005251
Gene Symbol FOXC2
Gene ID (NCBI) 2303
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purfication
UNIPROT IDQ99958
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Forkhead box protein C2 (FOXC2) also known as forkhead-related protein FKHL14 (FKHL14), transcription factor FKH-14, or mesenchyme fork head protein 1 (MFH1) is a protein that in humans is encoded by the FOXC2 gene. FOXC2 is a member of the fork head box (FOX) family of transcription factors. FOX transcription factors are expressed during development and are associated with a number of cellular and developmental differentiation processes. FOXC2 is required during early development of the kidneys, including differentiation of podocytes and maturation of the glomerular basement membrane. It is also involved in the early development of the heart. FOXC2 is also involved in cancer metastases. In particular, expression of FOXC2 is induced when epithelial cells undergo an epithelial-mesenchymal transition (EMT) and become mesenchymal looking cells. (PMID: 8674414 9169153 19935708) This antibody recognizes the 56 kDa FOXC2 protein, but the phosphorylated FOXC2 may be a 56-65 kDa protein. The 62kDa band was also detected in the study(PMID: 19540201).

Loading...
||
New chat

Able

正在加载,请稍候...