NELF Recombinant monoclonal antibody, PBS Only (Detector)

NELF Uni-rAb® Recombinant Antibody for WB, Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test
Cat No. 83490-2-PBS
Clone No.240482G1

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test

NSMF, 240482G1, Nasal embryonic LHRH factor, Nasal embryonic luteinizing hormone-releasing hormone factor, NMDA receptor synaptonuclear signaling and neuronal migration factor

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

83490-2-PBS targets NELF as part of a matched antibody pair:

MP00490-1: 83490-1-PBS capture and 83490-2-PBS detection (validated in Cytometric bead array, Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag34902

Product name: Recombinant human NELF protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 151-268 aa of BC016862

Sequence: KLNVYHKGAKIWKMLIFCQGGPGHLYLLKNKVATFAKVEKEEDMIHFWKRLSRLMSKVNPEPNVIHIMGCYILGNPNGEKLFQNLRTLMTPYRVTFESPLELSAQGKQMIETYFDFRL

Predict reactive species
Full Name nasal embryonic LHRH factor
Calculated Molecular Weight 507 aa, 56 kDa
GenBank Accession NumberBC016862
Gene Symbol NELF
Gene ID (NCBI) 26012
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ6X4W1
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

NSMF, also named as NELF (Nasal embryonic LHRH factor), couples NMDA-sensitive glutamate receptor signaling to the nucleus and triggers long-lasting changes in the cytoarchitecture of dendrites and spine synapse processes. NELF plays a major role in promoter-proximal pausing, a widespread phenomenon during early transcription elongation.

Loading...
||
New chat

Able

正在加载,请稍候...