Product Information
83490-2-PBS targets NELF as part of a matched antibody pair:
MP00490-1: 83490-1-PBS capture and 83490-2-PBS detection (validated in Cytometric bead array, Sandwich ELISA)
Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.
This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag34902 Product name: Recombinant human NELF protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 151-268 aa of BC016862 Sequence: KLNVYHKGAKIWKMLIFCQGGPGHLYLLKNKVATFAKVEKEEDMIHFWKRLSRLMSKVNPEPNVIHIMGCYILGNPNGEKLFQNLRTLMTPYRVTFESPLELSAQGKQMIETYFDFRL Predict reactive species |
| Full Name | nasal embryonic LHRH factor |
| Calculated Molecular Weight | 507 aa, 56 kDa |
| GenBank Accession Number | BC016862 |
| Gene Symbol | NELF |
| Gene ID (NCBI) | 26012 |
| RRID | AB_3671117 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q6X4W1 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
NSMF, also named as NELF (Nasal embryonic LHRH factor), couples NMDA-sensitive glutamate receptor signaling to the nucleus and triggers long-lasting changes in the cytoarchitecture of dendrites and spine synapse processes. NELF plays a major role in promoter-proximal pausing, a widespread phenomenon during early transcription elongation.









