GPR105 Recombinant monoclonal antibody, PBS Only (Detector)

GPR105 Uni-rAb® Recombinant Antibody for WB, Cytometric bead array, Indirect ELISA
Cat No. 83511-1-PBS
Clone No.240498B10

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Cytometric bead array, Indirect ELISA

P2RY14, P2Y purinoceptor 14, KIAA0001, G-protein coupled receptor 105, G protein coupled receptor 105

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

83511-1-PBS targets GPR105 as part of a matched antibody pair:

MP00509-1: 83511-2-PBS capture and 83511-1-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag14105

Product name: Recombinant human GPR105 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 249-338 aa of BC034989

Sequence: YHIARIPYTKSQTEAHYSCQSKEILRYMKEFTLLLSAANVCLDPIIYFFLCQPFREILCKKLHIPLKAQNDLDISRIKRGNTTLESTDTL

Predict reactive species
Full Name purinergic receptor P2Y, G-protein coupled, 14
Calculated Molecular Weight 338 aa, 39 kDa
GenBank Accession NumberBC034989
Gene Symbol P2RY14
Gene ID (NCBI) 9934
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ15391
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.
Loading...
||
New chat Able
正在加载,请稍候...