Use Able AI chat for product recommendations

SMPD2 Recombinant monoclonal antibody, PBS Only (Detector)

SMPD2 Uni-rAb® Recombinant Antibody for WB, FC (Intra), Cytometric bead array, Indirect ELISA

Cat No. 83520-3-PBS
Clone No.240400B5

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, FC (Intra), Cytometric bead array, Indirect ELISA

240400B5, EC:3.1.4.12, Lyso-PAF-PLC, Lyso-platelet-activating factor-phospholipase C, Neutral sphingomyelinase

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

83520-3-PBS targets SMPD2 as part of a matched antibody pair:

MP00518-1: 83520-1-PBS capture and 83520-3-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag7367

Product name: Recombinant human SMPD2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-301 aa of BC000038

Sequence: MKPNFSLRLRIFNLNCWGIPYLSKHRADRMRRLGDFLNQESFDLALLEEVWSEQDFQYLRQKLSPTYPAAHHFRSGIIGSGLCVFSKHPIQELTQHIYTLNGYPYMIHHGDWFSGKAVGLLVLHLSGMVLNAYVTHLHAEYNRQKDIYLAHRVAQAWELAQFIHHTSKKADVVLLCGDLNMHPEDLGCCLLKEWTGLHDAYLETRDFKGSEEGNTMVPKNCYVSQQELKPFPFGVRIDYVLYKAVSGFYISCKSFETTTGFDPHSGTPLSDHEALMATLFVRHSPPQQNPSSTHGPAERSP

Predict reactive species
Full Name sphingomyelin phosphodiesterase 2, neutral membrane (neutral sphingomyelinase)
Calculated Molecular Weight 48 kDa
GenBank Accession NumberBC000038
Gene Symbol SMPD2
Gene ID (NCBI) 6610
RRIDAB_3671146
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO60906
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

SMPD2, Sphingomyelin phosphodiesterase 2, is also named as Lyso-platelet-activating factor-phospholipase C and neutral sphingomyelinase (nSMase). It is involved in the sphingolipid metabolism pathway, which can catalyze the hydrolysis of sphingomyelin to form ceramide and phosphocholine. Smpd2/Smpd3 double-mutant mice were found to have severe retardation of late embryonic and postnatal growth and delayed puberty, belonging to hypothalamus-induced combined pituitary hormone deficiency (PubMed: 15764706).

Loading...
||
New chat

Able

正在加载,请稍候...