Product Information
83527-3-PBS targets SLC35B4 as part of a matched antibody pair:
MP00497-1: 83527-3-PBS capture and 83527-2-PBS detection (validated in Cytometric bead array)
Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.
This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag22669 Product name: Recombinant human SLC35B4 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-70 aa of BC008413 Sequence: MRPALAVGLVFAGCCSNVIFLELLARKHPGCGNIVTFAQFLFIAVEGFLFEADLGRKPPAIPIRYYAIMV Predict reactive species |
| Full Name | solute carrier family 35, member B4 |
| GenBank Accession Number | BC008413 |
| Gene Symbol | SLC35B4 |
| Gene ID (NCBI) | 84912 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q969S0 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
SLC35B4 (solute carrier family 35 member B4), also known as YEA. It is expected to be located in the endoplasmic reticulum membrane, which is ubiquitinated in placenta and brain. SLC35B4 is a glycosyltransferase, which transports nucleotide sugars from the cytoplasm where they are synthesized, to the Golgi apparatus where they are utilized in the synthesis of glycoproteins, glycolipids, and proteoglycans (PMID: 15911612). Belongs to the nucleotide-sugar transporter family. SLC35B subfamily. The molecular weight of SLC35B4 is 37 kDa.
