• All
  • Primary Antibodies
  • Conjugated Antibodies for IF
  • Conjugated Antibodies for FC
  • Secondary Antibodies
  • Antibody Labeling KitsNew
  • ELISA Kits
  • IHC Kits
  • Magnetic Cell Separation Kits
  • Cytokines & Growth Factors
  • Neutralizing/activating Antibodies
  • Nanobody-based Reagents
  • Accessory Products and Kits
  • Fusion Proteins
×
×
Host
0
Species Reactivity
0
Species Reactivity
0
Conjugate
0
Conjugate
0
Compatible Species
0
Conjugate
0
Use Able AI chat for product recommendations
Filter:
  • Western Blot (WB) analysis of various lysates using CNOT4 Recombinant antibody (83615-4-RR)

    WB analysis using 83615-4-RR

    Various lysates were subjected to SDS PAGE followed by western blot with 83615-4-RR (CNOT4 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

  • Immunohistochemistry (IHC) staining of human ovary cancer tissue using CNOT4 Recombinant antibody (83615-4-RR)

    IHC staining of human ovary cancer using 83615-4-RR

    Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 83615-4-RR (CNOT4 antibody) at dilution of 1:300 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  • Immunofluorescence (IF) / fluorescent staining of HeLa cells using CNOT4 Recombinant antibody (83615-4-RR)

    IF Staining of HeLa using 83615-4-RR

    Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using CNOT4 antibody (83615-4-RR, Clone: 240559E1 ) at dilution of 1:250 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2).

  • Flow cytometry (FC) experiment of HeLa cells using CNOT4 Recombinant antibody (83615-4-RR)

    FC experiment of HeLa using 83615-4-RR

    1x10^6 HeLa cells were intracellularly stained with 0.25 ug Cnot4 Recombinant Antibody (83615-4-RR, Clone:240559E1) and APC-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L)(red), or 0.25 ug Isotype Control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

  • Affinity and Kinetic Characterization of 83615-4-RR

    Affinity and Kinetic Characterization of 83615-4-RR

    Biolayer interferometry (BLl) kinetic assays of 83615-4-RR against Human CNOT4 were performed. The affinity constant is 0.485 nM.

CNOT4 Recombinant monoclonal antibody

CNOT4 Uni-rAb® Recombinant Antibody for WB, IHC, IF/ICC, FC (Intra), ELISA
Cat No. 83615-4-RR
Clone No.240559E1

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, FC (Intra), ELISA

Synonyms

240559E1, CCR4 associated factor 4, CCR4-associated factor 4, CCR4-NOT transcription complex subunit 4, CLONE243

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Please visit your regions distributor:

Tested Applications

Positive WB detected inMCF-7 cells, HEK-293T cells, HeLa cells, K-562 cells, Jurkat cells, NIH/3T3 cells
Positive IHC detected inhuman ovary cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:150-1:600
Immunofluorescence (IF)/ICCIF/ICC : 1:125-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

83615-4-RR targets CNOT4 in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag3163

Product name: Recombinant human CNOT4 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 273-572 aa of BC035590

Sequence: IDKPSDSLSIGNGDNSQQISNSDTPSPPPGLSKSNPVIPISSSNHSARSPFEGAVTESQSLFSDIFRHPNPIPSGLPPFPSSPQTSSDWPTAPEPQSLFTSETIPVSSSTDWQAAFGFGSSKQPEDDLGFDPFDVTRKALADLIEKELSVQDQPSLSPTSLQNSSSHTTTAKGPGSGFLHPAAATNANSLNSTFSVLPQRFPQFQQHRAVYNSFSFPGQAARYPWMAFPRNSIMHLNHTANPTSNSNFLDLNLPPQHNTGLGGIPVAGEEEVKVSTMPLSTSSHSLQQGQQPTSLHTTVA

Predict reactive species
Full Name CCR4-NOT transcription complex, subunit 4
Calculated Molecular Weight 575 aa, 64 kDa
Observed Molecular Weight 64-85 kDa
GenBank Accession NumberBC035590
Gene Symbol CNOT4
Gene ID (NCBI) 4850
RRIDAB_3671229
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO95628
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CNOT4, also known as CCR4-NOT transcription complex subunit 4 , has E3 ubiquitin ligase activity, and promotes ubiquitination and degradation of target proteins. CNOT4 is involved in activation of the JAK/STAT pathway. CNOT4 exist many isoforms and the range of its molecular weight from 48 to 84 kDa.

Protocols

Product Specific Protocols
FC protocol for CNOT4 antibody 83615-4-RRDownload protocol
IF protocol for CNOT4 antibody 83615-4-RRDownload protocol
IHC protocol for CNOT4 antibody 83615-4-RRDownload protocol
WB protocol for CNOT4 antibody 83615-4-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
||
New chat Able
正在加载，请稍候...