Neurofibromin Recombinant monoclonal antibody

Neurofibromin Uni-rAb® Recombinant Antibody for WB, FC (Intra), ELISA
Cat No. 83620-5-RR
Clone No.240540F2

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, FC (Intra), ELISA

NF1, 240540F2, neurofibromin 1, NF 1, NF-1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA431 cells, PC-12 cell, NIH/3T3 cells, HEK-293T cells, HeLa cells
Positive FC (Intra) detected inHeLa cells, U2OS cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

83620-5-RR targets Neurofibromin in WB, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag25799

Product name: Recombinant human Neurofibromin protein

Source: e coli.-derived, PET30a

Tag: 6*His

Domain: 1-100 aa of M60915

Sequence: MAAHRPVEWVQAVVSRFDEQLPIKTGQQNTHTKVSTEHNKECLINISKYKFSLVISGLTTILKNVNNMRIFGEAAEKNLYLSQLIILDTLEKCLAGQPKD

Predict reactive species
Full Name neurofibromin 1
Calculated Molecular Weight 319 kDa
Observed Molecular Weight250-280 kDa
GenBank Accession NumberM60915
Gene Symbol Neurofibromin 1
Gene ID (NCBI) 4763
RRIDAB_3671233
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP21359
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

NF1 codes for neurofibromin, a GTPase-activating protein that negatively regulates RAS/MAPK pathway activity by accelerating the hydrolysis of Ras-bound GTP. NF1 has a high mutation rate and mutations in NF1 can alter cellular growth control, and neural development, resulting in neurofibromatosis type 1 (NF1, also known as von Recklinghausen syndrome).

Protocols

Product Specific Protocols
FC protocol for Neurofibromin antibody 83620-5-RRDownload protocol
WB protocol for Neurofibromin antibody 83620-5-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...