Neurofibromin Recombinant monoclonal antibody, PBS Only (Capture)

• 

  WB analysis using 83620-5-RR (same clone as 83620-5-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 83620-5-RR (Neurofibromin antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 83620-5-PBS in a different storage buffer formulation.

• 

  FC experiment of U2OS using 83620-5-RR (same clone as 83620-5-PBS)

  1x10^6 U2OS cells were intracellularly stained with 0.25 ug Neurofibromin 1 Recombinant antibody (83620-5-RR, Clone:240540F2) and APC-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L)(red), or 0.25 ug Isotype Control (blue). Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011). This data was developed using the same antibody clone with 83620-5-PBS in a different storage buffer formulation.

• 

  FC experiment of HeLa using 83620-5-RR (same clone as 83620-5-PBS)

  1x10^6 HeLa cells were intracellularly stained with 0.25 ug Neurofibromin 1 Recombinant antibody (83620-5-RR, Clone:240540F2) and APC-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L)(red), or 0.25 ug Isotype Control (blue). Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011). This data was developed using the same antibody clone with 83620-5-PBS in a different storage buffer formulation.

• 

  Cytometric bead array standard curve of MP00570-2

  Cytometric bead array standard curve of MP00570-2, Neurofibromin Recombinant Matched Antibody Pair, PBS Only. Capture antibody: 83620-5-PBS. Detection antibody: 83620-4-PBS. Standard: Ag25799. Range: 0.313-40 ng/mL.

• 

  Affinity and Kinetic Characterization of 83620-5-PBS

  Biolayer interferometry (BLl) kinetic assay of 83620-5-PBS against Human Neurofibromin 1 was performed. The affinity constant is 68.2 pM.

• 

  Affinity and Kinetic Characterization of 83620-5-RR

  Biolayer interferometry (BLl) kinetic assays of 83620-5-RR against Human Neurofibromin 1 were performed. The affinity constant is below 1 pM.

Neurofibromin Uni-rAb^® Recombinant Antibody for WB, FC (Intra), Cytometric bead array, Indirect ELISA

Cat No. 83620-5-PBS

Clone No.240540F2

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, FC (Intra), Cytometric bead array, Indirect ELISA

Synonyms

NF1, 240540F2, neurofibromin 1, NF 1, NF-1

---

Product Information

83620-5-PBS targets Neurofibromin as part of a matched antibody pair:

MP00570-2: 83620-5-PBS capture and 83620-4-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag25799

  Product name: Recombinant human Neurofibromin protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 1-100 aa of M60915

  Sequence: MAAHRPVEWVQAVVSRFDEQLPIKTGQQNTHTKVSTEHNKECLINISKYKFSLVISGLTTILKNVNNMRIFGEAAEKNLYLSQLIILDTLEKCLAGQPKD

• Full Name: neurofibromin 1
• Calculated Molecular Weight: 319 kDa
• Observed Molecular Weight: 250-280 kDa
• GenBank Accession Number: M60915
• Gene Symbol: Neurofibromin 1
• Gene ID (NCBI): 4763
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P21359
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

NF1 codes for neurofibromin, a GTPase-activating protein that negatively regulates RAS/MAPK pathway activity by accelerating the hydrolysis of Ras-bound GTP. NF1 has a high mutation rate and mutations in NF1 can alter cellular growth control, and neural development, resulting in neurofibromatosis type 1 (NF1, also known as von Recklinghausen syndrome).