Neurofibromin Recombinant monoclonal antibody, PBS Only (Capture)

Neurofibromin Uni-rAb® Recombinant Antibody for WB, FC (Intra), Cytometric bead array, Indirect ELISA
Cat No. 83620-5-PBS
Clone No.240540F2

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, FC (Intra), Cytometric bead array, Indirect ELISA

NF1, 240540F2, neurofibromin 1, NF 1, NF-1

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

83620-5-PBS targets Neurofibromin as part of a matched antibody pair:

MP00570-2: 83620-5-PBS capture and 83620-4-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag25799

Product name: Recombinant human Neurofibromin protein

Source: e coli.-derived, PET30a

Tag: 6*His

Domain: 1-100 aa of M60915

Sequence: MAAHRPVEWVQAVVSRFDEQLPIKTGQQNTHTKVSTEHNKECLINISKYKFSLVISGLTTILKNVNNMRIFGEAAEKNLYLSQLIILDTLEKCLAGQPKD

Predict reactive species
Full Name neurofibromin 1
Calculated Molecular Weight 319 kDa
Observed Molecular Weight250-280 kDa
GenBank Accession NumberM60915
Gene Symbol Neurofibromin 1
Gene ID (NCBI) 4763
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP21359
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

NF1 codes for neurofibromin, a GTPase-activating protein that negatively regulates RAS/MAPK pathway activity by accelerating the hydrolysis of Ras-bound GTP. NF1 has a high mutation rate and mutations in NF1 can alter cellular growth control, and neural development, resulting in neurofibromatosis type 1 (NF1, also known as von Recklinghausen syndrome).

Loading...
||
New chat Able
正在加载,请稍候...