• All
  • Primary Antibodies
  • Conjugated Antibodies for IF
  • Conjugated Antibodies for FC
  • Secondary Antibodies
  • Antibody Labeling KitsNew
  • ELISA Kits
  • IHC Kits
  • Magnetic Cell Separation Kits
  • Cytokines & Growth Factors
  • Neutralizing/activating Antibodies
  • Nanobody-based Reagents
  • Accessory Products and Kits
  • Fusion Proteins
×
×
Host
0
Species Reactivity
0
Species Reactivity
0
Conjugate
0
Conjugate
0
Compatible Species
0
Conjugate
0
Use Able AI chat for product recommendations
Filter:
  • Sandwich ELISA standard curve of MP00626-3

    Sandwich ELISA standard curve of MP00626-3

    Sandwich ELISA standard curve of MP00626-3, Human CEA/CD66e Recombinant Matched Antibody Pair - PBS only. 83653-1-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Eg0449. 83653-3-PBS was HRP conjugated as the detection antibody. Range: 7.8-500 pg/mL

  • Sample test of MP00626-3

    Sample test of MP00626-3

    Saliva of eight individual healthy human donors was measured. The human CEA/CD66e concentration of detected samples was determined to be 4,297.5 pg/mL with a range of 1,476.6 - 9,827.4 pg/mL.

  • Sample test of MP00626-3

    Sample test of MP00626-3

    The mean CEA/CD66e concentration was determined to be 1,780.9 pg/mL in MCF-7 cell extract based on a 1.5 mg/mL extract load.

  • Sample test of MP00626-3

    Sample test of MP00626-3

    Serum of sixteen individual healthy human donors was measured. The human CEA/CD66e concentration of detected samples was determined to be 351.5 pg/mL with a range of 100.4 - 1,305.8 pg/mL.

  • Cytometric bead array standard curve of MP00626-3

    Cytometric bead array standard curve of MP00626-3

    Cytometric bead array standard curve of MP00626-3, CEA/CD66e Recombinant Matched Antibody Pair, PBS Only. Capture antibody: 83653-1-PBS. Detection antibody: 83653-3-PBS. Standard: Eg0449. Range: 0.625-80 ng/mL.

  • Affinity and Kinetic Characterization of 83653-1-PBS

    Affinity and Kinetic Characterization of 83653-1-PBS

    Biolayer interferometry (BLl) kinetic assays of 83653-1-PBS against Human CEA/CD66e were performed. The affinity constant is 1.76 nM.

CEA/CD66e Recombinant monoclonal antibody, PBS Only (Capture)

CEA/CD66e Uni-rAb® Recombinant Antibody for Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test
Cat No. 83653-1-PBS
Clone No.240666B6

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test

Synonyms

CEA, Carcinoembryonic antigen, Carcinoembryonic antigen-related cell adhesion molecule 5, CD66e, CEACAM5

Formulation:  PBS Only
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Please visit your regions distributor:

Product Information

83653-1-PBS targets CEA/CD66e as part of a matched antibody pair:

MP00626-3: 83653-1-PBS capture and 83653-3-PBS detection (validated in Cytometric bead array, Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg0449

Product name: Recombinant Human CEA/CD66e protein (His Tag)(HPLC verified)

Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

Tag: C-6*HIS

Domain: 35-685 aa of NM_004363

Sequence: KLTIESTPFNVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNRQIIGYVIGTQQATPGPAYSGREIIYPNASLLIQNIIQNDTGFYTLHVIKSDLVNEEATGQFRVYPELPKPSISSNNSKPVEDKDAVAFTCEPETQDATYLWWVNNQSLPVSPRLQLSNGNRTLTLFNVTRNDTASYKCETQNPVSARRSDSVILNVLYGPDAPTISPLNTSYRSGENLNLSCHAASNPPAQYSWFVNGTFQQSTQELFIPNITVNNSGSYTCQAHNSDTGLNRTTVTTITVYAEPPKPFITSNNSNPVEDEDAVALTCEPEIQNTTYLWWVNNQSLPVSPRLQLSNDNRTLTLLSVTRNDVGPYECGIQNKLSVDHSDPVILNVLYGPDDPTISPSYTYYRPGVNLSLSCHAASNPPAQYSWLIDGNIQQHTQELFISNITEKNSGLYTCQANNSASGHSRTTVKTITVSAELPKPSISSNNSKPVEDKDAVAFTCEPEAQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLFNVTRNDARAYVCGIQNSVSANRSDPVTLDVLYGPDTPIISPPDSSYLSGANLNLSCHSASNPSPQYSWRINGIPQQHTQVLFIAKITPNNNGTYACFVSNLATGRNNSIVKSITVSASGTSPGLSA

Predict reactive species
Full Name carcinoembryonic antigen-related cell adhesion molecule 5
Calculated Molecular Weight 77 kDa
GenBank Accession NumberNM_004363
Gene Symbol CEA
Gene ID (NCBI) 1048
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP06731-1
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.
||
New chat Able
正在加载，请稍候...