CDK9 Recombinant monoclonal antibody, PBS Only (Detector)

CDK9 Uni-rAb® Recombinant Antibody for WB, IHC, IF/ICC, FC (Intra), Sandwich ELISA, Indirect ELISA, Sample test
Cat No. 83662-2-PBS
Clone No.240600E3

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, FC (Intra), Sandwich ELISA, Indirect ELISA, Sample test

240600E3, C 2k, C-2K, CDC2L4, Cell division cycle 2-like protein kinase 4

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

83662-2-PBS targets CDK9 as part of a matched antibody pair:

MP00630-4: 83662-6-PBS capture and 83662-2-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag2318

Product name: Recombinant human CDK9 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-372 aa of BC001968

Sequence: MAKQYDSVECPFCDEVSKYEKLAKIGQGTFGEVFKARHRKTGQKVALKKVLMENEKEGFPITALREIKILQLLKHENVVNLIEICRTKASPYNRCKGSIYLVFDFCEHDLAGLLSNVLVKFTLSEIKRVMQMLLNGLYYIHRNKILHRDMKAANVLITRDGVLKLADFGLARAFSLAKNSQPNRYTNRVVTLWYRPPELLLGERDYGPPIDLWGAGCIMAEMWTRSPIMQGNTEQHQLALISQLCGSITPEVWPNVDNYELYEKLELVKGQKRKVKDRLKAYVRDPYALDLIDKLLVLDPAQRIDSDDALNHDFFWSDPMPSDLKGMLSTHLTSMFEYLAPPRRKGSQITQQSTNQSRNPATTNQTEFERVF

Predict reactive species
Full Name cyclin-dependent kinase 9
Calculated Molecular Weight 372 aa, 43 kDa
Observed Molecular Weight 38-42 kDa, 55 kDa
GenBank Accession NumberBC001968
Gene Symbol CDK9
Gene ID (NCBI) 1025
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP50750
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

CDK9(Cyclin-dependent kinase 9) is a member of the Cdc2-like family of kinases. Its cyclin partners are members of the family of cyclin T (T1, T2a and T2b) and cyclin K. The CDK9/cyclin T complexes appear to be involved in regulating several physiological processes. CDK9 has also been described as the kinase of the TAK complex, which is homologous to the P-TEFb complex and involved in HIV replication. In addition, CDK9 seems to have an anti-apoptotic function in monocytes, that may be related to its control over differentiation of monocytes (PMID: 12432243). CDK9 has two isoforms with the molecular mass of 42 kDa and 55 kDa, and the relative abundance of Cdk9(42kDa) and Cdk9(55kDa) changes in different cell types (PMID: 12706900, 15780980).

Loading...
||
New chat Able
正在加载,请稍候...