Use Able AI chat for product recommendations

FTCD Recombinant monoclonal antibody, PBS Only (Capture)

FTCD Uni-rAb® Recombinant Antibody for WB, Cytometric bead array, Sandwich ELISA, Indirect ELISA

Cat No. 83664-2-PBS
Clone No.240654G9

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Cytometric bead array, Sandwich ELISA, Indirect ELISA

240654G9, Formimidoyltetrahydrofolate cyclodeaminase, Formimidoyltransferase-cyclodeaminase, Formiminotransferase-cyclodeaminase, Glutamate formimidoyltransferase

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

83664-2-PBS targets FTCD as part of a matched antibody pair:

MP00636-1: 83664-2-PBS capture and 83664-3-PBS detection (validated in Cytometric bead array)

MP00636-3: 83664-2-PBS capture and 83664-4-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag16646

Product name: Recombinant human FTCD protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 192-541 aa of BC136395

Sequence: TKEQAHRIALNLREQGRGKDQPGRLKKVQGIGWYLDEKNLAQVSTNLLDFEVTALHTVYEETCREAQELSLPVVGSQLVGLVPLKALLDAAAFYCEKENLFILEEEQRIRLVVSRLGLDSLCPFSPKERIIEYLVPERGPERGLGSKSLRAFVGEVGARSAAPGGGSVAAAAAAMGAALGSMVGLMTYGRRQFQSLDTTMRRLIPPFREASAKLTTLVDADAEAFTAYLEAMRLPKNTPEEKDRRTAALQEGLRRAVSVPLTLAETVASLWPALQELARCGNLACRSDLQVAAKALEMGVFGAYFNVLINLRDITDEAFKDQIHHRVSSLLQEAKTQAALVLDCLETRQE

Predict reactive species
Full Name formiminotransferase cyclodeaminase
Calculated Molecular Weight 541 aa, 59 kDa
Observed Molecular Weight58 kDa
GenBank Accession NumberBC136395
Gene Symbol FTCD
Gene ID (NCBI) 10841
RRIDAB_3671271
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO95954
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

FTCD (formimidoyltransferase cyclodeaminase) is critical for the catabolism of histidine, a . This process is one-carbon units that can enter the one-carbon/folate cycle, which provides methyl groups for arsenic metabolism (PMID: 30893314). In addition, FTCD could serve as a predictive and prognostic marker for patients with HCC (PMID: 37675273).

Loading...
||
New chat

Able

正在加载,请稍候...