USP4 Recombinant monoclonal antibody, PBS Only (Capture)

USP4 Uni-rAb® Recombinant Antibody for WB, IHC, FC (Intra), Cytometric bead array, Indirect ELISA
Cat No. 83734-2-PBS
Clone No.240797B11

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, FC (Intra), Cytometric bead array, Indirect ELISA

240797B11, EC:3.4.19.12, Ubiquitin carboxyl-terminal hydrolase 4, Ubiquitin-specific-processing protease 4, UNP

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

83734-2-PBS targets USP4 as part of a matched antibody pair:

MP00717-1: 83734-2-PBS capture and 83734-4-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag28297

Product name: Recombinant human USP4 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 567-779 aa of BC125131

Sequence: VCSTSVDGSECVTLPVYFRERKSRPSSTSSASALYGQPLLLSVPKHKLTLESLYQAVCDRISRYVKQPLPDEFGSSPLEPGACNGSRNSCEGEDEEEMEHQEEGKEQLSETEGSGEDEPGNDPSETTQKKIKGQPCPKRLFTFSLVNSYGTADINSLAADGKLLKLNSRSTLAMDWDSETRRLYYDEQESEAYEKHVSMLQPQKKKKTTVALR

Predict reactive species
Full Name ubiquitin specific peptidase 4 (proto-oncogene)
Calculated Molecular Weight 963 aa, 109 kDa
Observed Molecular Weight 109 kDa
GenBank Accession NumberBC125131
Gene Symbol USP4
Gene ID (NCBI) 7375
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ13107
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

USP4, also known as UNP and UNPH, belongs to the peptidase C19 family and USP4 subfamily. USP4 is a deubiquitinating enzyme that links to mitogen-activated protein kinase signaling, pre-mRNA splicing, and control of p53 stability (PMID: 26455393). USP4 has 3 isoforms with the molecular mass of 36, 104 and 109 kDa. Recently, it has been reported that USP4 is a critical factor in promoting lung cancer stemness and potentially useful lung cancer prognosis marker (PMID: 32549341).

Loading...
||
New chat Able
正在加载,请稍候...