USP4 Recombinant monoclonal antibody

USP4 Uni-rAb® Recombinant Antibody for WB, IHC, FC (Intra), ELISA
Cat No. 83734-2-RR
Clone No.240797B11

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, FC (Intra), ELISA

240797B11, EC:3.4.19.12, Ubiquitin carboxyl-terminal hydrolase 4, Ubiquitin-specific-processing protease 4, UNP

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inTHP-1 cells, NCI-H1299 cells, K-562 cells, Jurkat cells, MCF-7 cells, HeLa cells, HepG2 cells
Positive IHC detected inhuman ovary cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive FC (Intra) detected inU-251 cells, HeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:300-1:1200
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

83734-2-RR targets USP4 in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag28297

Product name: Recombinant human USP4 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 567-779 aa of BC125131

Sequence: VCSTSVDGSECVTLPVYFRERKSRPSSTSSASALYGQPLLLSVPKHKLTLESLYQAVCDRISRYVKQPLPDEFGSSPLEPGACNGSRNSCEGEDEEEMEHQEEGKEQLSETEGSGEDEPGNDPSETTQKKIKGQPCPKRLFTFSLVNSYGTADINSLAADGKLLKLNSRSTLAMDWDSETRRLYYDEQESEAYEKHVSMLQPQKKKKTTVALR

Predict reactive species
Full Name ubiquitin specific peptidase 4 (proto-oncogene)
Calculated Molecular Weight 963 aa, 109 kDa
Observed Molecular Weight 109 kDa
GenBank Accession NumberBC125131
Gene Symbol USP4
Gene ID (NCBI) 7375
RRIDAB_3671334
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ13107
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

USP4, also known as UNP and UNPH, belongs to the peptidase C19 family and USP4 subfamily. USP4 is a deubiquitinating enzyme that links to mitogen-activated protein kinase signaling, pre-mRNA splicing, and control of p53 stability (PMID: 26455393). USP4 has 3 isoforms with the molecular mass of 36, 104 and 109 kDa. Recently, it has been reported that USP4 is a critical factor in promoting lung cancer stemness and potentially useful lung cancer prognosis marker (PMID: 32549341).

Protocols

Product Specific Protocols
IHC protocol for USP4 antibody 83734-2-RRDownload protocol
WB protocol for USP4 antibody 83734-2-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...