Tested Applications
| Positive WB detected in | Saos-2 cells, MG-63 cells |
| Positive IHC detected in | human skin tissue, human placenta tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HSC-T6 cells |
| Positive FC (Intra) detected in | SW480 cells, HSC-T6 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:125-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
83752-5-RR targets Collagen Type I in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, rat samples.
| Tested Reactivity | human, rat |
| Cited Reactivity | mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag6281 Product name: Recombinant human COL1A2 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1017-1366 aa of BC054498 Sequence: RGLPGLKGHNGLQGLPGIAGHHGDQGAPGSVGPAGPRGPAGPSGPAGKDGRTGHPGTVGPAGIRGPQGHQGPAGPPGPPGPPGPPGVSGGGYDFGYDGDFYRADQPRSAPSLRPKDYEVDATLKSLNNQIETLLTPEGSRKNPARTCRDLRLSHPEWSSGYYWIDPNQGCTMDAIKVYCDFSTGETCIRAQPENIPAKNWYRSSKDKKHVWLGETINAGSQFEYNVEGVTSKEMATQLAFMRLLANYASQNITYHCKNSIAYMDEETGNLKKAVILQGSNDVELVAEGNSRFTYTVLVDGCSKKTNEWGKTIIEYKTNKPSRLPFLDIAPLDIGGADQEFFVDIGPVCFK Predict reactive species |
| Full Name | collagen, type I, alpha 2 |
| Calculated Molecular Weight | 1366 aa, 130 kDa |
| Observed Molecular Weight | 100-160 kDa |
| GenBank Accession Number | BC054498 |
| Gene Symbol | COL1A2 |
| Gene ID (NCBI) | 1278 |
| RRID | AB_3671349 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purfication |
| UNIPROT ID | P08123 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Type I collagen, the major structural component of connective tissues such as skin, tendon and bone, is the most abundant and widely expressed collagen in humans (PMID: 7620364; 8645190; 9016532). Type I collagen is a heterotrimer comprising one alpha 2(I) and two alpha 1(I) chains which are encoded by the unlinked loci COL1A2 and COL1A1 respectively. Type I collagen has a molecular mass of about 250-300 kDa, while the alpha 2(I) chain has a molecular weight of about 100-140 kDa. Mutations in COL1A2 gene are associated with osteogenesis imperfecta, Ehlers-Danlos syndrome, idiopathic osteoporosis, and atypical Marfan syndrome. This antibody raised against 1017-1366 aa of human pro-alpha 2 chain of type l collagen can recognize collagen alpha 2(1) chain and C-terminal propeptide of pro-alpha 2(1) chain.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for Collagen Type I antibody 83752-5-RR | Download protocol |
| IF protocol for Collagen Type I antibody 83752-5-RR | Download protocol |
| IHC protocol for Collagen Type I antibody 83752-5-RR | Download protocol |
| WB protocol for Collagen Type I antibody 83752-5-RR | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The Collagen Type I Recombinant monoclonal antibody (240665F8), catalog number 83752-5-RR, has 13 total citations. These appear in journals including Bioactive Materials, Biomaterials, International Journal of Biological Macromolecules, Regenerative Biomaterials, ACS Applied Materials & Interfaces, Biochemical Pharmacology, Molecular and Cellular Biochemistry, Brain Research Bulletin, FASEB Journal, and Fitoterapia. Research fields span bone biology and implant osseointegration, wound healing, liver and cardiac fibrosis, stroke recovery, hydrocephalus, reproductive medicine, and ferroptosis-related pathology.
| Species | Application | Title |
|---|---|---|
Bioact Mater Chiral Fe(3)O(4)/GelMA hydrogels regulate the osteoimmune microenvironment via Itgb3-mediated macrophage polarization to combat peri-implantitis. | ||
Bioact Mater Mitochondrial micro-nano reactors via enhancing mitochondrial transfer and mitophagy for alleviating metabolic crisis. | ||
Biomaterials Sprayable polysaccharide-based biomimetic double dressing with synergistic regulation for wound healing. | ||
Regen Biomater Shockwave-driven activation of endoplasmic reticulum stress in osteoblasts to enhance bone formation under osteoporotic conditions. | ||
Int J Biol Macromol Protamine-loaded quaternized chitosan hydrogel dressing featuring antibacterial and antioxidant properties for promoting postoperative periodontal wound healing. | ||
Int J Biol Macromol Modification of 3D printed porous titanium implants with on-demand delivery of curcumin and stromal cell derived factor-1 for osseointegration improvement. |
