RAB11FIP5 Recombinant monoclonal antibody, PBS Only (Detector)

RAB11FIP5 Uni-rAb® Recombinant Antibody for WB, Cytometric bead array, Indirect ELISA
Cat No. 83939-2-PBS
Clone No.241038E11

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Cytometric bead array, Indirect ELISA

241038E11, GAF1, Gaf-1, Gamma-SNAP-associated factor 1, Rab11 family-interacting protein 5

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

83939-2-PBS targets RAB11FIP5 as part of a matched antibody pair:

MP00924-2: 83939-3-PBS capture and 83939-2-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag6128

Product name: Recombinant human RAB11FIP5 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-250 aa of BC035013

Sequence: MALVRGAEPAAGPSRWLPTHVQVTVLRARGLRGKSSGAGSTSDAYTVIQVGREKYSTSVVEKTHGCPEWREECSFELPPGALDGLLRAQEADAGPAPWAASSAAACELVLTTMHRSLIGVDKFLGQATVALDEVFGAGRAQHTQWYKLHSKPGKKEKERGEIEVTIQFTRNNLSAMFDLSMKDKPRSPFSKIRDKMKGKKKYDLESASAILPSSAIEDPDLGSLGKMGKAKGFFLRNKLRKSSLTQSNTS

Predict reactive species
Full Name RAB11 family interacting protein 5 (class I)
Calculated Molecular Weight 70 kDa
Observed Molecular Weight70 kDa
GenBank Accession NumberBC035013
Gene Symbol RAB11FIP5
Gene ID (NCBI) 26056
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9BXF6
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Rab11 family-interacting protein 5 (Rab11fip5) is an adaptor protein that binds to the small GTPase Rab11, which has an important function in endosome recycling and trafficking of cellular proteins to the plasma membrane. Rab11fip5 is involved in many cellular processes, such as cytoskeleton rearrangement, iron uptake and exocytosis in neuroendocrine cells, and is also known as a candidate gene for autism-spectrum disorder.

Loading...
||
New chat Able
正在加载,请稍候...