TPRG1L Recombinant monoclonal antibody, PBS Only (Detector)

TPRG1L Uni-rAb® Recombinant Antibody for WB, IHC, Cytometric bead array, Indirect ELISA
Cat No. 83989-3-PBS
Clone No.241070B8

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Cytometric bead array, Indirect ELISA

241070B8, FAM79A, h mover, Mossy fiber terminal-associated vertebrate-specific presynaptic protein, MOVER

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

83989-3-PBS targets TPRG1L as part of a matched antibody pair:

MP00883-1: 83989-1-PBS capture and 83989-3-PBS detection (validated in Cytometric bead array)

MP00883-3: 83989-2-PBS capture and 83989-3-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag22585

Product name: Recombinant human TPRG1L protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-117 aa of BC019034

Sequence: MLQLRDSVDSAGTSPTAVLAAGEEVGAGGGPGGGRPGAGTPLRQTLWPLSIHDPTRRARVKEYFVFRPGSIEQAVEEIRVVVRPVEDGEIQGVWLLTEREGFGIRIQWDKQSRPSFI

Predict reactive species
Full Name tumor protein p63 regulated 1-like
Observed Molecular Weight 30 kDa
GenBank Accession NumberBC019034
Gene Symbol TPRG1L
Gene ID (NCBI) 127262
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ5T0D9
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Presynaptic protein involved in the synaptic transmission tuning. Regulates synaptic release probability by decreasing the calcium sensitivity of release.

Loading...
||
New chat Able
正在加载,请稍候...