CRTAM/CD355 Recombinant monoclonal antibody

CRTAM/CD355 Uni-rAb® Recombinant Antibody for WB, IHC, IF-P, ELISA
Cat No. 84068-4-RR
Clone No.241280C4

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, ELISA

CRTAM, 241280C4, CD355, Class-I MHC-restricted T-cell-associated molecule, Cytotoxic and regulatory T-cell molecule

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inJurkat cells, K-562 cells, mouse brain tissue, rat brain tissue, mouse spleen tissue, mouse cerebellum tissue
Positive IHC detected inmouse brain tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inmouse brain tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
Immunohistochemistry (IHC)IHC : 1:400-1:1600
Immunofluorescence (IF)-PIF-P : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

84068-4-RR targets CRTAM/CD355 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg1541

Product name: Recombinant Human CRTAM protein (His Tag)

Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

Tag: C-6*HIS

Domain: 18-286 aa of NM_019604.4

Sequence: SLTNHTETITVEEGQTLTLKCVTSLRKNSSLQWLTPSGFTIFLNEYPALKNSKYQLLHHSANQLSITVPNVTLQDEGVYKCLHYSDSVSTKEVKVIVLATPFKPILEASVIRKQNGEEHVVLMCSTMRSKPPPQITWLLGNSMEVSGGTLHEFETDGKKCNTTSTLIIHTYGKNSTVDCIIRHRGLQGRKLVAPFRFEDLVTDEETASDALERNSLSSQDPQQPTSTVSVTEDSSTSEIDKEEKEQTTQDPDLTTEANPQYLGLARKKS

Predict reactive species
Full Name cytotoxic and regulatory T cell molecule
Calculated Molecular Weight45 kDa
Observed Molecular Weight70 kDa
GenBank Accession NumberNM_019604.4
Gene Symbol CRTAM
Gene ID (NCBI) 56253
RRIDAB_3671636
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purfication
UNIPROT IDO95727-1
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Cytotoxic and regulatory T cell molecule (CRTAM, also known as CD355) is an immunoglobulin-superfamily transmembrane protein with V and C1-like Ig domains, which is involved in epithelial cell adhesion (PMID: 18329370; 20556794). CRTAM is critical to instruct the differentiation of CD4+ cytotoxic T cells (CTL) through the induction of eomesodermin and CTL-related genes (PMID: 26694968). It also regulates CD8+ T cell retention within the lymph node and eventually effector function (PMID: 19752223). The predicted molecular weight of CRTAM is 43 kDa. Due to glycosylation, the observed molecular weight of CRTAM can be apparent at ~80 kDa (PMID: 16300832).

Protocols

Product Specific Protocols
IF protocol for CRTAM/CD355 antibody 84068-4-RRDownload protocol
IHC protocol for CRTAM/CD355 antibody 84068-4-RRDownload protocol
WB protocol for CRTAM/CD355 antibody 84068-4-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...