CRTAM/CD355 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 84068-4-RR (same clone as 84068-4-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 84068-4-RR (CRTAM/CD355 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 84068-4-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 84068-4-RR (same clone as 84068-4-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 84068-4-RR (CRTAM antibody) at dilution of 1:800 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84068-4-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse brain using 84068-4-RR (same clone as 84068-4-PBS)

  Immunofluorescent analysis of (4% PFA) fixed mouse brain tissue using CRTAM antibody (84068-4-RR, Clone: 241280C4 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 84068-4-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 84068-4-RR

  Biolayer interferometry (BLl) kinetic assays of 84068-4-RR against Human CRTAM were performed. The affinity constant is 0.427 nM.

CRTAM/CD355 Uni-rAb^® Recombinant Antibody for WB, IHC, IF-P, Indirect ELISA

Cat No. 84068-4-PBS

Clone No.241280C4

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, Indirect ELISA

Synonyms

CRTAM, 241280C4, CD355, Class-I MHC-restricted T-cell-associated molecule, Cytotoxic and regulatory T-cell molecule

---

Product Information

84068-4-PBS targets CRTAM/CD355 in WB, IHC, IF-P, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg1541

  Product name: Recombinant Human CRTAM protein (His Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: C-6*HIS

  Domain: 18-286 aa of NM_019604.4

  Sequence: SLTNHTETITVEEGQTLTLKCVTSLRKNSSLQWLTPSGFTIFLNEYPALKNSKYQLLHHSANQLSITVPNVTLQDEGVYKCLHYSDSVSTKEVKVIVLATPFKPILEASVIRKQNGEEHVVLMCSTMRSKPPPQITWLLGNSMEVSGGTLHEFETDGKKCNTTSTLIIHTYGKNSTVDCIIRHRGLQGRKLVAPFRFEDLVTDEETASDALERNSLSSQDPQQPTSTVSVTEDSSTSEIDKEEKEQTTQDPDLTTEANPQYLGLARKKS

• Full Name: cytotoxic and regulatory T cell molecule
• Calculated Molecular Weight: 45 kDa
• Observed Molecular Weight: 70 kDa
• GenBank Accession Number: NM_019604.4
• Gene Symbol: CRTAM
• Gene ID (NCBI): 56253
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: O95727-1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Cytotoxic and regulatory T cell molecule (CRTAM, also known as CD355) is an immunoglobulin-superfamily transmembrane protein with V and C1-like Ig domains, which is involved in epithelial cell adhesion (PMID: 18329370; 20556794). CRTAM is critical to instruct the differentiation of CD4+ cytotoxic T cells (CTL) through the induction of eomesodermin and CTL-related genes (PMID: 26694968). It also regulates CD8+ T cell retention within the lymph node and eventually effector function (PMID: 19752223). The predicted molecular weight of CRTAM is 43 kDa. Due to glycosylation, the observed molecular weight of CRTAM can be apparent at ~80 kDa (PMID: 16300832).