Tested Applications
| Positive WB detected in | LPS and Brefeldin A treated THP-1 cells, LPS and Brefeldin A treated RAW 264.7 cells, PMA, LPS and Brefeldin A treated RAW 264.7 cells |
| Positive IF/ICC detected in | LPS and Brefeldin A treated RAW 264.7 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:500-1:2000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
84136-5-RR targets IL-1 beta in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Eg1577 Product name: Recombinant Mouse IL-1 beta protein (His Tag) Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS Tag: N-6*His Domain: 118-269 aa of NM_008361.4 Sequence: VPIRQLHYRLRDEQQKSLVLSDPYELKALHLNGQNINQQVIFSMSFVQGEPSNDKIPVALGLKGKNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKSKVEFESAEFPNWYISTSQAEHKPVFLGNNSGQDIIDFTMESVSS Predict reactive species |
| Full Name | interleukin 1 beta |
| Calculated Molecular Weight | 31kDa |
| Observed Molecular Weight | 31 kDa |
| GenBank Accession Number | NM_008361.4 |
| Gene Symbol | IL-1 beta |
| Gene ID (NCBI) | 16176 |
| RRID | AB_3671695 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P10749 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Interleukin-1, produced mainly by blood monocytes, mediates the panoply of host reactions collectively known as acute phase response. It is identical to endogenous pyrogen. The multiple biologic activities that define IL1 are properties of a 15- to 18-kD protein that is derived from a 30- to 35-kD precursor. Interleukin 1β (IL-1B) is a member of the interleukin 1 cytokine family. It is a pro-inflammatory cytokine against infection, playing an important role in the pathogenesis of cancers. It signals through various adaptor proteins and kinases that lead to activation of numerous downstream targets.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for IL-1 beta antibody 84136-5-RR | Download protocol |
| WB protocol for IL-1 beta antibody 84136-5-RR | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The IL-1 beta Recombinant monoclonal antibody (241364D5), catalog number 84136-5-RR, has 2 citations. One appears in Journal of Ethnopharmacology, studying atherosclerosis and vascular inflammation via the NF-κB/NLRP3 pathway in ApoE-deficient mice. The other is in Cell Signaling, investigating uric acid-induced renal fibrosis through the SMAD5/Id2 signaling pathway. Both studies used the antibody for Western blot in mouse samples, covering cardiovascular inflammation and renal fibrosis research fields.
| Species | Application | Title |
|---|---|---|
J Ethnopharmacol Shenling Jiangzhi formula alleviates atherosclerosis in ApoE(-/-) mice by inhibiting vascular inflammation via the NF-κB/NLRP3 pathway. | ||
Cell Signal MicroRNA-93-5p alleviates uric acid-induced fibrosis in renal tubular epithelial cells by regulating the SMAD5/Id2 signaling pathway. |
