Mouse IL-1 beta Recombinant monoclonal antibody, PBS Only

• 

  WB analysis of THP-1 using 84136-5-RR (same clone as 84136-5-PBS)

  LPS and Brefeldin A treated THP-1 cells were subjected to SDS PAGE followed by western blot with 84136-5-RR (IL-1 beta antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 84136-5-PBS in a different storage buffer formulation.

• 

  WB analysis using 84136-5-RR (same clone as 84136-5-PBS)

  LPS and Brefeldin A treated RAW264.7 cells were subjected to SDS PAGE followed by western blot with 84136-5-RR (IL-1 beta antibody) at dilution of 1:4000, incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 84136-5-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 84136-5-RR

  Biolayer interferometry (BLl) kinetic assays of 84136-5-RR against Mouse IL-1 beta were performed. The affinity constant is 13.2 pM.

IL-1 beta Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 84136-5-PBS

Clone No.241364D5

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Indirect ELISA

Synonyms

IL 1beta, Il1b, 241364D5, IL 1 beta, Il 1b

---

Product Information

84136-5-PBS targets IL-1 beta in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg1577

  Product name: Recombinant Mouse IL-1 beta protein (His Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: N-6*His

  Domain: 118-269 aa of NM_008361.4

  Sequence: VPIRQLHYRLRDEQQKSLVLSDPYELKALHLNGQNINQQVIFSMSFVQGEPSNDKIPVALGLKGKNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKSKVEFESAEFPNWYISTSQAEHKPVFLGNNSGQDIIDFTMESVSS

• Full Name: interleukin 1 beta
• Calculated Molecular Weight: 31kDa
• Observed Molecular Weight: 31 kDa
• GenBank Accession Number: NM_008361.4
• Gene Symbol: IL-1 beta
• Gene ID (NCBI): 16176
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: P10749
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Interleukin-1, produced mainly by blood monocytes, mediates the panoply of host reactions collectively known as acute phase response. It is identical to endogenous pyrogen. The multiple biologic activities that define IL1 are properties of a 15- to 18-kD protein that is derived from a 30- to 35-kD precursor. Interleukin 1β (IL-1B) is a member of the interleukin 1 cytokine family. It is a pro-inflammatory cytokine against infection, playing an important role in the pathogenesis of cancers. It signals through various adaptor proteins and kinases that lead to activation of numerous downstream targets.