CD3EAP Recombinant monoclonal antibody, PBS Only (Capture/Detector)

CD3EAP Uni-rAb® Recombinant Antibody for Cytometric bead array, Indirect ELISA
Cat No. 84139-2-PBS
Clone No.241379D8

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Cytometric bead array, Indirect ELISA

A34.5, Antisense to ERCC-1 protein, ASE1, ASE-1, CAST

Formulation:  PBS Only
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

84139-2-PBS targets CD3EAP as part of a matched antibody pair:

MP01056-1: 84139-2-PBS capture and 84139-3-PBS detection (validated in Cytometric bead array)

MP01056-2: 84139-2-PBS capture and 84139-1-PBS detection (validated in Cytometric bead array)

MP01056-3: 84139-4-PBS capture and 84139-2-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag35074

Product name: Recombinant human CD3EAP protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-130 aa of BC038992

Sequence: MEEPQAGDAARFSCPPNFTAKPPASESPRFSLEALTGPDTELWLIQAPADFAPECFNGRHVPLSGSQIVKGKLAGKRHRYRVLSSCPQAGEATLLAPSTEAGGGLTCASAPQGTLRILEGPQQSLSGSPL

Predict reactive species
Full Name CD3e molecule, epsilon associated protein
Calculated Molecular Weight 510 aa, 55 kDa
GenBank Accession NumberBC038992
Gene Symbol CD3EAP
Gene ID (NCBI) 10849
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO15446
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.
Loading...
||
New chat Able
正在加载,请稍候...