Tested Applications
| Positive WB detected in | LPS and Brefeldin A treated NR8383 cells |
| Positive IF/ICC detected in | LPS and Brefeldin A treated RAW 264.7 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:2000-1:8000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
84274-1-RR targets IL-1 beta in WB, IF/ICC, ELISA applications and shows reactivity with mouse, rat samples.
| Tested Reactivity | mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Eg31371 Product name: Recombinant Rat IL-1 beta protein (Myc Tag, His Tag) Source: mammalian cells-derived, pHZ-KIsec Tag: Myc & 6*His Domain: 117-268 aa of NM_031512 Sequence: VPIRQLHCRLRDEQQKCLVLSDPCELKALHLNGQNISQQVVFSMSFVQGETSNDKIPVALGLKGLNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKTKVEFESAQFPNWYISTSQAEHRPVFLGNSNGRDIVDFTMEPVSS Predict reactive species |
| Full Name | interleukin 1 beta |
| Calculated Molecular Weight | 31 kDa |
| Observed Molecular Weight | 31 kDa |
| GenBank Accession Number | NM_031512 |
| Gene Symbol | IL-1 beta |
| Gene ID (NCBI) | 24494 |
| RRID | AB_3743543 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q63264 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Interleukin-1, produced mainly by blood monocytes, mediates the panoply of host reactions collectively known as acute phase response. It is identical to endogenous pyrogen. The multiple biologic activities that define IL1 are properties of a 15- to 18-kD protein that is derived from a 30- to 35-kD precursor. Interleukin 1β (IL-1B) is a member of the interleukin 1 cytokine family. It is a pro-inflammatory cytokine against infection, playing an important role in the pathogenesis of cancers. It signals through various adaptor proteins and kinases that lead to activation of numerous downstream targets.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for IL-1 beta antibody 84274-1-RR | Download protocol |
| WB protocol for IL-1 beta antibody 84274-1-RR | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The IL-1β Recombinant Monoclonal Antibody (241001H8), catalog number 84274-1-RR, has 2 total citations. Both appear in the Journal of Ethnopharmacology. The research fields span ethnopharmacology and traditional medicine: one study investigates Chaihu-Shugan-San's effect on functional dyspepsia via NMDAR/CaMKII signaling, while the other examines Tibetan medicine Anzhi Jinghua San in chronic atrophic gastritis, focusing on Bcl-2 regulation, pyroptosis, and apoptosis.
| Species | Application | Title |
|---|---|---|
J Ethnopharmacol Chaihu-Shugan-San alleviates functional dyspepsia by inhibiting central sensitization and regulating glutamate metabolism via NMDAR/CaMKII signaling pathway. | ||
J Ethnopharmacol Tibetan medicine Anzhi Jinghua San alleviates chronic atrophic gastritis: attenuation of LysoPC-induced Bcl-2 suppression and inhibition of pyroptosis and apoptosis. |
