MAP2 Recombinant monoclonal antibody

MAP2 Uni-rAb® Recombinant Antibody for WB, IHC, IF-P, IF-Fro, ELISA
Cat No. 84306-3-RR
Clone No.241653E9

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, IF-Fro, ELISA

241653E9, MAP 2, MAP-2, MAP2A, MAP2B

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inSH-SY5Y cells, mouse brain tissue, rat brain tissue
Positive IHC detected inmouse cerebellum tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inrat brain tissue
Positive IF-Fro detected inmouse brain tissue, rat brain tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
Immunohistochemistry (IHC)IHC : 1:2000-1:8000
Immunofluorescence (IF)-PIF-P : 1:125-1:500
Immunofluorescence (IF)-FROIF-FRO : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

84306-3-RR targets MAP2 in WB, IHC, IF-P, IF-Fro, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag11580

Product name: Recombinant human MAP2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 213-559 aa of BC038857

Sequence: TSAGSTDRLPYSKSGNKDGVTKSPEKRSSLPRPSSILPPRRGVSGDRDENSFSLNSSISSSARRTTRSEPIRRAGKSGTSTPTTPGSTAITPGTPPSYSSRTPGTPGTPSYPRTPHTPGTPKSAILVPSEKKVAIIRTPPKSPATPKQLRLINQPLPDLKNVKSKIGSTDNIKYQPKGGQVRILNKKIDFSKVQSRCGSKDNIKHSAGGGNVQIVTKKIDLSHVTSKCGSLKNIRHRPGGGRVKIESVKLDFKEKAQAKVGSLDNAHHVPGGGNVKIDSQKLNFREHAKARVDHGAEIITQSPGRSSVASPRRLSNVSSSGSINLLESPQLATLAEDVTAALAKQGL

Predict reactive species
Full Name microtubule-associated protein 2
Calculated Molecular Weight 200 kDa
Observed Molecular Weight280-300 kDa, 70-85 kDa
GenBank Accession NumberBC038857
Gene Symbol MAP2
Gene ID (NCBI) 4133
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP11137
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MAP2 (microtubule-associated protein 2) is a cytoskeleton protein abundant in the brain and has an important role in neuronal morphogenesis. Multiple high MW and low MW MAP2 isoforms are expressed within the proximal segment of axons, dendrites, and cell bodies. The expression of MAP2 is regulated in both a tissue- and developmentally-specific manner. The 280 kDa MAP2B is present throughout rat brain development, and the slightly larger MAP2A appears first during the end of the second week of postnatal life. MAP2C, composed of several bands of about 70 kDa, is present during early brain development and largely disappears from the mature brain except for the retina, olfactory bulb, and cerebellum. In addition, some isoforms with lower MW around 50-60 kDa also exist. MAP2 antibodies have been widely used to mark the neuron or dendrite formation.

Protocols

Product Specific Protocols
IF protocol for MAP2 antibody 84306-3-RRDownload protocol
IHC protocol for MAP2 antibody 84306-3-RRDownload protocol
WB protocol for MAP2 antibody 84306-3-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...