GADD45A Recombinant monoclonal antibody

GADD45A Recombinant Antibody for WB, FC (Intra), ELISA
Cat No. 84376-4-RR
Clone No.241597H4

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, FC (Intra), ELISA

GADD45, DNA damage-inducible transcript 1 protein, DDIT-1, DDIT1, DDIT 1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inK-562 cells, NIH/3T3 cells
Positive FC (Intra) detected inU-2 OS, K562

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

84376-4-RR targets GADD45A in WB, FC (Intra), ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag4687

Product name: Recombinant human GADD45A protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 5-165 aa of BC011757

Sequence: EFSAGEQKTERMDKVGDALEEVLSKALSQRTITVGVYEAAKLLNVDPDNVVLCLLAADEDDDRDVALQIHFTLIQAFCCENDINILRVSNPGRLAELLLLETDAGPAASEGAEQPPDLHCVLVTNPHSSQWKDPALSQLICFCRESRYMDQWVPVINLPER

Predict reactive species
Full Name growth arrest and DNA-damage-inducible, alpha
Calculated Molecular Weight 165 aa, 18 kDa
Observed Molecular Weight14-18 kDa, 28-36 kDa
GenBank Accession NumberBC011757
Gene Symbol GADD45A
Gene ID (NCBI) 1647
RRIDAB_3671913
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP24522
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

GADD45A, also named as DDIT1 and GADD45, belongs to the GADD45 family. It binds to proliferating cell nuclear antigen. GADD45A may affect PCNA interaction with some CDK (cell division protein kinase) complexes; stimulates DNA excision repair in vitro and inhibits entry of cells into S phase. GADD45A plays an essential role in active DNA demethylation during terminal osteogenic differentiation of adipose-derived mesenchymal stem cells. GADD45A has Dimer (~28-36 kDa) and Monomer (14-18 kDa) forms (PMID:11498536).

Protocols

Product Specific Protocols
WB protocol for GADD45A antibody 84376-4-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...