GADD45A Recombinant monoclonal antibody, PBS Only (Capture)

GADD45A Uni-rAb® Recombinant Antibody for WB, FC (Intra), Cytometric bead array, Indirect ELISA
Cat No. 84376-4-PBS
Clone No.241597H4

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, FC (Intra), Cytometric bead array, Indirect ELISA

241597H4, DDIT 1, DDIT1, DDIT-1, DNA damage-inducible transcript 1 protein

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

84376-4-PBS targets GADD45A as part of a matched antibody pair:

MP01247-2: 84376-4-PBS capture and 84376-1-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag4687

Product name: Recombinant human GADD45A protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 5-165 aa of BC011757

Sequence: EFSAGEQKTERMDKVGDALEEVLSKALSQRTITVGVYEAAKLLNVDPDNVVLCLLAADEDDDRDVALQIHFTLIQAFCCENDINILRVSNPGRLAELLLLETDAGPAASEGAEQPPDLHCVLVTNPHSSQWKDPALSQLICFCRESRYMDQWVPVINLPER

Predict reactive species
Full Name growth arrest and DNA-damage-inducible, alpha
Calculated Molecular Weight 165 aa, 18 kDa
Observed Molecular Weight14-18 kDa, 28-36 kDa
GenBank Accession NumberBC011757
Gene Symbol GADD45A
Gene ID (NCBI) 1647
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP24522
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

GADD45A, also named as DDIT1 and GADD45, belongs to the GADD45 family. It binds to proliferating cell nuclear antigen. GADD45A may affect PCNA interaction with some CDK (cell division protein kinase) complexes; stimulates DNA excision repair in vitro and inhibits entry of cells into S phase. GADD45A plays an essential role in active DNA demethylation during terminal osteogenic differentiation of adipose-derived mesenchymal stem cells. GADD45A has Dimer (~28-36 kDa) and Monomer (14-18 kDa) forms (PMID:11498536).

Loading...
||
New chat Able
正在加载,请稍候...