MLL4 Recombinant monoclonal antibody, PBS Only (Capture)

MLL4 Uni-rAb® Recombinant Antibody for WB, Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test
Cat No. 84410-1-PBS
Clone No.241819A4

Host / Isotype

Rabbit / IgG

Reactivity

human, rat

Applications

WB, Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test

241819A4, CXXC10 , DYT28, HRX2, KIAA0304

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

84410-1-PBS targets MLL4 as part of a matched antibody pair:

MP01298-1: 84410-1-PBS capture and 84410-2-PBS detection (validated in Cytometric bead array, Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag35385

Product name: Recombinant human MLL4 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 800-982 aa of BC009337

Sequence: KVQLFKIDQQQQQKVAASMPLSPGGQMEEVAGAVKQISDRGPVRSEDESVEAKRERPSGPESPVQGPRIKHVCRHAAVALGQARAMVPEDVPRLSALPLRDRQDLATEDTSSASETESVPSRSRRGKVEAAGPGGESEPTGSGGTLAHTPRRSLPSHHGKKMRMARCGHCRGCLRVQDCGSCV

Predict reactive species
Full Name myeloid/lymphoid or mixed-lineage leukemia 4
Observed Molecular Weight 294 kDa
GenBank Accession NumberBC009337
Gene Symbol MLL4
Gene ID (NCBI) 9757
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9UMN6
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

MLL4, also known as KMT2B, which is an essential subunit of the H3K4 methylation complexes, regulates cell type-specific transcriptional programs through enhancer activation. Taspase 1 mediates cleavage of the MLL protein, generating cleavage products.

Loading...
||
New chat Able
正在加载,请稍候...