Mouse EPCAM/CD326 Recombinant monoclonal antibody, PBS Only (Capture)

EPCAM/CD326 Uni-rAb® Recombinant Antibody for WB, IHC, IF-P, Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test
Cat No. 84490-2-PBS
Clone No.241851E11

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

WB, IHC, IF-P, Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test

241851E11, CD326, EGP314, Epcam, Ep-CAM

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

84490-2-PBS targets EPCAM/CD326 as part of a matched antibody pair:

MP01344-1: 84490-2-PBS capture and 84490-3-PBS detection (validated in Cytometric bead array, Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg1883

Product name: Recombinant mouse EpCAM/TROP1 protein

Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

Tag: C-6*HIS

Domain: 24-266 aa of NM_008532.2

Sequence: QRDCVCDNYKLATSCSLNEYGECQCTSYGTQNTVICSKLASKCLAMKAEMTHSKSGRRIKPEGAIQNNDGLYDPDCDEQGLFKAKQCNGTATCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKERESPYDHQSLQTALQEAFTSRYKLNQKFIKNIMYENNVITIDLMQNSSQKTQDDVDIADVAYYFEKDVKGESLFHSSKSMDLRVNGEPLDLDPGQTLIYYVDEKAPEFSMQGLT

Predict reactive species
Full Name epithelial cell adhesion molecule
Calculated Molecular Weight35 kDa
Observed Molecular Weight35 kDa, 40 kDa
GenBank Accession NumberNM_008532.2
Gene Symbol Epcam
Gene ID (NCBI) 17075
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ99JW5
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Epithelial cell adhesion molecule (EpCAM, CD326) is a type I transmembrane glycoprotein that functions as a homophilic, epithelial-specific intercellular cell-adhesion molecule. In addition to cell adhesion, EpCAM is also involved in cellular signaling, cell migration, proliferation, and differentiation. EpCAM is highly expressed on most carcinomas and therefore of potential use as a diagnostic and prognostic marker for a variety of carcinomas, and has become a therapeutic target. EpCAM may occur in distinct forms due to glycosylation. (PMID: 20837599; 19249674; 21576002; 22647938; 12691820)

Loading...
||
New chat

Able

正在加载,请稍候...