Mouse EPCR/CD201 Recombinant monoclonal antibody, PBS Only (Capture)

EPCR/CD201 Uni-rAb® Recombinant Antibody for WB, IHC, IF/ICC, IF-P, Cytometric bead array, Sandwich ELISA, Indirect ELISA
Cat No. 84494-2-PBS
Clone No.241853A9

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

WB, IHC, IF/ICC, IF-P, Cytometric bead array, Sandwich ELISA, Indirect ELISA

241853A9, Activated protein C receptor, APC receptor, CD201, Centrocyclin

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

84494-2-PBS targets EPCR/CD201 as part of a matched antibody pair:

MP01323-3: 84494-2-PBS capture and 84494-3-PBS detection (validated in Cytometric bead array, Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg1517

Product name: Recombinant Mouse EPCR/CD201 protein (rFc Tag)(HPLC verified)

Source: mammalian cells-derived, pHZ-KIsec-C-rFc

Tag: C-rFc

Domain: 18-214 aa of NM_011171.2

Sequence: LCNSDGSQSLHMLQISYFQDNHHVRHQGNASLGKLLTHTLEGPSQNVTILQLQPWQDPESWERTESGLQIYLTQFESLVKLVYRERKENVFFPLTVSCSLGCELPEEEEEGSEPHVFFDVAVNGSAFVSFRPKTAVWVSGSQEPSKAANFTLKQLNAYNRTRYELQEFLQDTCVEFLENHITTQNMKGSQTGRSYTS

Predict reactive species
Full Name protein C receptor, endothelial
Calculated Molecular Weight27kDa
Observed Molecular Weight40-50 kDa
GenBank Accession NumberNM_011171.2
Gene Symbol PROCR
Gene ID (NCBI) 19124
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ64695
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Protein C receptor (PROCR), also known as activated protein C receptor (APC receptor), EPCR, or CD201, is a transmembrane glycoprotein. EPCR promotes the activation of protein C, which has anticoagulant and cytoprotective effects. EPCR facilitates the activation of protein C by the thrombin-thrombomodulin complex but also facilitates APC-mediated cytoprotective impact on cells that involve the activation of protease-activated receptors (PAR) 1 and 3(PMID: 27207424).

Loading...
||
New chat

Able

正在加载,请稍候...