Filter: AllWBSandwich ELISA sample testSandwich ELISAIHCIF/ICCFC (Intra)Affinity

WB analysis using 84581-3-RR (same clone as 84581-3-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 84581-3-RR (TRAF2 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 84581-3-PBS in a different storage buffer formulation.
Sandwich ELISA sample test of MP01404-2
The mean TRAF2 concentration was determined to be 94.50 ng/mL in HeLa cell extract based on a 1.50 mg/mL extract load, 59.04 ng/mL in MOLT-4 cell extract based on a 1.20 mg/mL extract load, 25.97 ng/mL in PC-3 cell extract based on a 2.00 mg/mL extract load and 18.85 ng/mL in NIH/3T3 cell extract based on a 1.50 mg/mL extract load.
Sandwich ELISA standard curve of MP01404-2
Sandwich ELISA standard curve of MP01404-2, Human TRAF2 Recombinant Matched Antibody Pair - PBS only. 84581-3-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Ag25387. 84581-1-PBS was HRP conjugated as the detection antibody. Range: 3.13-200 ng/mL.
IHC staining of human ovary cancer using 84581-3-RR (same clone as 84581-3-PBS)
Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 84581-3-RR (TRAF2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84581-3-PBS in a different storage buffer formulation.
IHC staining of human ovary cancer using 84581-3-RR (same clone as 84581-3-PBS)
Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 84581-3-RR (TRAF2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84581-3-PBS in a different storage buffer formulation.
IHC staining of human rectal cancer using 84581-3-RR (same clone as 84581-3-PBS)
Immunohistochemical analysis of paraffin-embedded human rectal cancer tissue slide using 84581-3-RR (TRAF2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84581-3-PBS in a different storage buffer formulation.
IHC staining of human rectal cancer using 84581-3-RR (same clone as 84581-3-PBS)
Immunohistochemical analysis of paraffin-embedded human rectal cancer tissue slide using 84581-3-RR (TRAF2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84581-3-PBS in a different storage buffer formulation.
IF Staining of HeLa using 84581-3-RR (same clone as 84581-3-PBS)
Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using TRAF2 antibody (84581-3-RR, Clone: 241899A2 ) at dilution of 1:1000 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 84581-3-PBS in a different storage buffer formulation.
FC experiment of HeLa using 84581-3-RR (same clone as 84581-3-PBS)
1x10^6 HeLa cells were intracellularly stained with 0.25 ug TRAF2 Recombinant antibody (84581-3-RR, Clone:241899A2) and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.25 ug Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 84581-3-PBS in a different storage buffer formulation.
×
1x10^6 HeLa cells were intracellularly stained with 0.25 ug TRAF2 Recombinant antibody (84581-3-RR, Clone:241899A2) and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.25 ug Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 84581-3-PBS in a different storage buffer formulation.
Affinity and Kinetic Characterization of 84581-3-RR
Biolayer interferometry (BLl) kinetic assays of 84581-3-RR against Human TRAF2 were performed. The affinity constant is 0.544 nM.

TRAF2 Recombinant monoclonal antibody, PBS Only (Capture)

TRAF2 Uni-rAb^® Recombinant Antibody for WB, IHC, IF/ICC, FC (Intra), Sandwich ELISA, Indirect ELISA

Cat No. 84581-3-PBS

Clone No.241899A2

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, FC (Intra), Sandwich ELISA, Indirect ELISA

Synonyms

241899A2, E3 ubiquitin-protein ligase TRAF2, EC:2.3.2.27, RING-type E3 ubiquitin transferase TRAF2, TNF receptor-associated factor 2

Formulation: PBS Only

PBS, Azide, Glycerol

PBS Only

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

84581-3-PBS targets TRAF2 as part of a matched antibody pair:

MP01404-2: 84581-3-PBS capture and 84581-1-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity	human, mouse
Host / Isotype	Rabbit / IgG
Class	Recombinant
Type	Antibody
Immunogen	CatNo: Ag25387 Product name: Recombinant human TRAF2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 438-501 aa of BC032410 Sequence: NNREHVIDAFRPDVTSSSFQRPVNDMNIASGCPLFCPVSKMEAKNSYVRDDAIFIKAIVDLTGL Predict reactive species
Full Name	TNF receptor-associated factor 2
Calculated Molecular Weight	56 kDa
Observed Molecular Weight	53 kDa
GenBank Accession Number	BC032410
Gene Symbol	TRAF2
Gene ID (NCBI)	7186
Conjugate	Unconjugated
Form	Liquid
Purification Method	Protein A purfication
UNIPROT ID	Q12933
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

Tumor necrosis factor (TNF) receptor-associated factor-2 (TRAF2) is one of the members of the TRAF superfamily protein, which is an intracellular junction protein with E3 ligase activity. TRAF2 mediates and regulates the activation of nuclear factor kappa B (NF-κB) and microtubule-associated protein kinase (MAPK) signaling pathways by binding to TNFR family proteins. Recent studies have demonstrated that TRAF2 regulates tumor progression by through multiple pathways.