Tested Applications
| Positive WB detected in | HeLa cells, HEK-293T cells, HepG2 cells, MOLT-4 cells. NIH/3T3 cells, C2C12 cells |
| Positive IHC detected in | human ovary cancer tissue, human rectal cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
| Positive FC (Intra) detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:10000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:500-1:2000 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
84581-3-RR targets TRAF2 in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag25387 Product name: Recombinant human TRAF2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 438-501 aa of BC032410 Sequence: NNREHVIDAFRPDVTSSSFQRPVNDMNIASGCPLFCPVSKMEAKNSYVRDDAIFIKAIVDLTGL Predict reactive species |
| Full Name | TNF receptor-associated factor 2 |
| Calculated Molecular Weight | 56 kDa |
| Observed Molecular Weight | 53 kDa |
| GenBank Accession Number | BC032410 |
| Gene Symbol | TRAF2 |
| Gene ID (NCBI) | 7186 |
| RRID | AB_3672080 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q12933 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Tumor necrosis factor (TNF) receptor-associated factor-2 (TRAF2) is one of the members of the TRAF superfamily protein, which is an intracellular junction protein with E3 ligase activity. TRAF2 mediates and regulates the activation of nuclear factor kappa B (NF-κB) and microtubule-associated protein kinase (MAPK) signaling pathways by binding to TNFR family proteins. Recent studies have demonstrated that TRAF2 regulates tumor progression by through multiple pathways.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for TRAF2 antibody 84581-3-RR | Download protocol |
| IF protocol for TRAF2 antibody 84581-3-RR | Download protocol |
| IHC protocol for TRAF2 antibody 84581-3-RR | Download protocol |
| WB protocol for TRAF2 antibody 84581-3-RR | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The TRAF2 Recombinant monoclonal antibody (241899A2), catalog number 84581-3-RR, has 1 citation. It appears in Journal of Cellular and Molecular Medicine (2025), in a study investigating how the flavonoid kaempferol mitigates periprosthetic osteolysis by regulating the NLRP3 inflammasome and balancing bone metabolism. The research field encompasses bone biology, inflammasome signaling, and pharmacology. The antibody was applied in immunofluorescence (IF) using mouse samples.
| Species | Application | Title |
|---|---|---|
J Cell Mol Med The Flavonoid Kaempferol Mitigates Periprosthetic Osteolysis by Regulating the NLRP3 Inflammasome and Balancing Bone Metabolism. |
