BTD Recombinant monoclonal antibody, PBS Only (Detector)

BTD Uni-rAb® Recombinant Antibody for WB, Cytometric bead array, Indirect ELISA
Cat No. 84613-2-PBS
Clone No.242057C3

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Cytometric bead array, Indirect ELISA

Biotinase, biotinidase, EC:3.5.1.12

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

84613-2-PBS targets BTD as part of a matched antibody pair:

MP01452-1: 84613-1-PBS capture and 84613-2-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag9449

Product name: Recombinant human BTD protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 194-543 aa of BC012099

Sequence: FNTNVVFSNNGTLVDRYRKHNLYFEAAFDVPLKVDLITFDTPFAGRFGIFTCFDILFFDPAIRVLRDYKVKHVVYPTAWMNQLPLLAAIEIQKAFAVAFGINVLAANVHHPVLGMTGSGIHTPLESFWYHDMENPKSHLIIAQVAKNPVGLIGAENATGETDPSHSKFLKILSGDPYCEKDAQEVHCDEATKWNVNAPPTFHSEMMYDNFTLVPVWGKEGYLHVCSNGLCCYLLYERPTLSKELYALGVFDGLHTVHGTYYIQVCALVRCGGLGFDTCGQEITEATGIFEFHLWGNFSTSYIFPLFLTSGMTLEVPDQLGWENDHYFLRKSRLSSGLVTAALYGRLYERD

Predict reactive species
Full Name biotinidase
Calculated Molecular Weight 543 aa, 61 kDa
Observed Molecular Weight61 kDa
GenBank Accession NumberBC012099
Gene Symbol BTD
Gene ID (NCBI) 686
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP43251
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

BTD(Biotinidase) functions to recycle protein-bound biotin by cleaving biocytin (biotin-epsilon-lysine), a normal product of carboxylase degradation, resulting in the regeneration of free biotin. BTD has also been shown to have biotinyl transferase activity.

Loading...
||
New chat Able
正在加载,请稍候...