PSMA/GCPII Recombinant monoclonal antibody, PBS Only (Capture)

PSMA/GCPII Uni-rAb® Recombinant Antibody for WB, IF/ICC, Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test
Cat No. 84615-2-PBS
Clone No.242026F4

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test

FOLH1, PSMA, 242026F4, Cell growth-inhibiting gene 27 protein, EC:3.4.17.21

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

84615-2-PBS targets PSMA/GCPII as part of a matched antibody pair:

MP01454-1: 84615-2-PBS capture and 84615-1-PBS detection (validated in Cytometric bead array, Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg0216

Product name: Recombinant Human PSMA/GCPII protein (His Tag)

Source: mammalian cells-derived, pHZ-KIsec

Tag: N-6*His

Domain: 44-750 aa of NM_004476.3

Sequence: KSSNEATNITPKHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFDKSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA

Predict reactive species
Full Name folate hydrolase (prostate-specific membrane antigen) 1
Calculated Molecular Weight84KD
Observed Molecular Weight100 kDa
GenBank Accession NumberNM_004476.3
Gene Symbol PSMA
Gene ID (NCBI) 2346
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ04609
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Prostate-specific membrane antigen (PSMA), also known as glutamate carboxypeptidase II (GCPII), is a type II transmembrane glycoprotein that has gained significant attention in the field of prostate cancer (PCa) diagnostics and therapeutics. PSMA is highly overexpressed in prostate cancer tissue, especially in aggressive, androgen-deprived, metastatic, and hormone-refractory prostate cancers. Up to 95% of prostate adenocarcinomas express PSMA receptors on their surface. Physiological expression of PSMA is observed in normal prostate epithelium, duodenum, colon, renal tubules, and sympathetic ganglia. It is also found in other tissues such as the salivary glands, lacrimal glands, and various parts of the gastrointestinal tract, though at lower levels.

Loading...
||
New chat

Able

正在加载,请稍候...