SETD5 Recombinant monoclonal antibody, PBS Only (Detector)

SETD5 Uni-rAb® Recombinant Antibody for IHC, IF/ICC, Cytometric bead array, Indirect ELISA
Cat No. 84622-1-PBS
Clone No.241903A3

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, IF/ICC, Cytometric bead array, Indirect ELISA

241903A3, Histone-lysine N-methyltransferase SETD5, KIAA1757

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

84622-1-PBS targets SETD5 as part of a matched antibody pair:

MP01432-1: 84622-2-PBS capture and 84622-1-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag28929

Product name: Recombinant human SETD5 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-202 aa of BC020956

Sequence: MHAFENLEKRKKRRDQPLEQSNSDVEITTTTSETPVGEETKTEAPESEVSNSVSNVTIPSTPQSVGVNTRRSSQAGDIAAEKLVPKPPPAKPSRPRPKSRISRYRTSSAQRLKRQKQANAQQAELSQAALEEGGSNSLVTPTEAGSLDSSGENRPLTGSDPTVVSITGSHVNRAASKYPKTKKYLVTEWLNDKAEKQECPVE

Predict reactive species
Full Name SET domain containing 5
GenBank Accession NumberBC020956
Gene Symbol SETD5
Gene ID (NCBI) 55209
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9C0A6
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

SETD5, also known as KIAA1757, is a member of the histone lysine methyltransferase family. It has 3 isoforms and is involved in a variety of cellular functions, including cell cycle regulation and cell proliferation, and has a potential role in early embryonic development (PMID: 36875494).

Loading...
||
New chat Able
正在加载,请稍候...