VRK2 Recombinant monoclonal antibody, PBS Only (Capture)

VRK2 Uni-rAb® Recombinant Antibody for WB, Cytometric bead array, Indirect ELISA
Cat No. 84663-1-PBS
Clone No.242180B2

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Cytometric bead array, Indirect ELISA

Vaccinia-related kinase 2, vaccinia related kinase 2, Serine/threonine-protein kinase VRK2, EC:2.7.11.1, 242180B2

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

84663-1-PBS targets VRK2 as part of a matched antibody pair:

MP01476-1: 84663-1-PBS capture and 84663-2-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag4019

Product name: Recombinant human VRK2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-353 aa of BC027854

Sequence: MPPKRNEKYKLPIPFPEGKVLDDMEGNQWVLGKKIGSGGFGLIYLAFPTNKPEKDARHVVKVEYQENGPLFSELKFYQRVAKKDCIKKWIERKQLDYLGIPLFYGSGLTEFKGRSYRFMVMERLGIDLQKISGQNGTFKKSTVLQLGIRMLDVLEYIHENEYVHGDVKAANLLLGYKNPDQVYLADYGLSYRYCPNGNHKQYQENPRKGHNGTIEFTSLDAHKGVALSRRSDVEILGYCMLRWLCGKLPWEQNLKDPVAVQTAKTNLLDELPQSVLKWAPSGSSCCEIAQFLVCAHSLAYDEKPNYQALKKILNPHGIPLGPLDFSTKGQSINVHTPNSQKVDSQKAATKQVN

Predict reactive species
Full Name vaccinia related kinase 2
Calculated Molecular Weight 508 aa, 58 kDa
Observed Molecular Weight 58 kDa
GenBank Accession NumberBC027854
Gene Symbol VRK2
Gene ID (NCBI) 7444
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ86Y07
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Vaccinia-related kinase 2 (VRK2) is a serine/threonine kinase that plays a significant role in various cellular processes, including cell survival, proliferation, and DNA damage response. The VRK2 gene is known to produce two main splice variants: VRK2A and VRK2B, with VRK2A being the predominant form in humans. VRK2 is involved in several key biological functions. It is known to enhance cell survival by acting as an anti-apoptotic factor, which is particularly crucial in cancer biology. The overexpression of VRK2 has been linked to increased drug sensitivity in cancer cells, suggesting that this kinase may play a role in therapeutic responses. Additionally, high levels of VRK2 protein have been associated with improved survival rates in specific subgroups of astrocytomas, a type of brain tumor. (PMID: 29872222; 37943248; 24079673)

Loading...
||
New chat Able
正在加载,请稍候...