KAT2A/GCN5 Recombinant monoclonal antibody, PBS Only (Capture)

KAT2A/GCN5 Uni-rAb® Recombinant Antibody for WB, IHC, IF/ICC, FC (Intra), Cytometric bead array, Indirect ELISA
Cat No. 84669-2-PBS
Clone No.242113C7

Host / Isotype

Rabbit / IgG

Reactivity

human, rat

Applications

WB, IHC, IF/ICC, FC (Intra), Cytometric bead array, Indirect ELISA

242113C7, EC:2.3.1.-, EC:2.3.1.48, GCN5, GCN5L2

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

84669-2-PBS targets KAT2A/GCN5 as part of a matched antibody pair:

MP01463-1: 84669-2-PBS capture and 84669-3-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag29005

Product name: Recombinant human KAT2A protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 366-449 aa of BC032743

Sequence: EIYGANSPIWESGFTMPPSEGTQLVPRPASVSAAVVPSTPIFSPSMGGGSNSSLSLDSAGAEPMPGEKRTLPENLTLEDAKRLR

Predict reactive species
Full Name K(lysine) acetyltransferase 2A
Calculated Molecular Weight 94 kDa
Observed Molecular Weight94 kDa
GenBank Accession NumberBC032743
Gene Symbol KAT2A
Gene ID (NCBI) 2648
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ92830
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

GCN5, encoded by KAT2A, is a member of nuclear A-type histone acetyltransferase (HAT) which has direct impact on gene transcription. Additionally, GCN5 has roles in cell cycle regulation, DNA replication, and DNA repair, highlighting it as key player in the maintenance of genome stability. GCN5 is a coactivator of c-MYC oncogene protein and has oncogenic roles in various cancers.

Loading...
||
New chat Able
正在加载,请稍候...