• Featured Product
  • KD/KO Validated

PSMD14/POH1 Recombinant monoclonal antibody, PBS Only (Detector)

PSMD14/POH1 Uni-rAb® Recombinant Antibody for WB, IHC, IF/ICC, Sandwich ELISA, Indirect ELISA, Sample test

Cat No. 84767-3-PBS
Clone No.242160E7

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, Sandwich ELISA, Indirect ELISA, Sample test

PSMD14, 242160E7, 26S proteasome non-ATPase regulatory subunit 14, 26S proteasome-associated PAD1 homolog 1, EC:3.4.19.-

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

84767-3-PBS targets PSMD14/POH1 as part of a matched antibody pair:

MP01566-3: 84767-1-PBS capture and 84767-3-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag2694

Product name: Recombinant human PSMD14 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-95 aa of BC009524

Sequence: MLLNLHKKSWMEGLTLQDYSEHCKHNESVVKEMLELAKNYNKAVEEEDKMTPEQLAIKNVGKQDPKRHLEEHVDVLMTSNIVQCLAAMLDTVVFK

Predict reactive species
Full Name proteasome (prosome, macropain) 26S subunit, non-ATPase, 14
Calculated Molecular Weight 35 kDa
Observed Molecular Weight33 kDa
GenBank Accession NumberBC009524
Gene Symbol PSMD14
Gene ID (NCBI) 10213
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO00487
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

The PSMD14 (POH1, also known as Rpn11/MPR1/S13/CepP1) protein is a metalloprotease component of the 26S proteasome that specifically cleaves 'Lys-63'-linked polyubiquitin chains. The 26S proteasome is involved in the ATP-dependent degradation of ubiquitinated proteins. PSMD14 is highly expressed in the heart and skeletal muscle. In carcinoma cell lines. down-regulation of PSMD14 by siRNA transfection had a considerable impact on cell viability causing cell arrest in the G0-G1 phase, ultimately leading to senescence.

Loading...
||
New chat

Able

正在加载,请稍候...