• All
  • Primary Antibodies
  • Conjugated Antibodies for IF
  • Conjugated Antibodies for FC
  • Secondary Antibodies
  • Antibody Labeling KitsNew
  • ELISA Kits
  • IHC Kits
  • Magnetic Cell Separation Kits
  • Cytokines & Growth Factors
  • Neutralizing/activating Antibodies
  • Nanobody-based Reagents
  • Accessory Products and Kits
  • Fusion Proteins
×
×
Host
0
Species Reactivity
0
Species Reactivity
0
Conjugate
0
Conjugate
0
Compatible Species
0
Conjugate
0
Use Able AI chat for product recommendations
Filter:
  • Western Blot (WB) analysis of various lysates using MCT4 Recombinant antibody (84797-4-RR)

    WB analysis using 84797-4-RR

    Various lysates were subjected to SDS PAGE followed by western blot with 84797-4-RR (MCT4 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  • Immunohistochemistry (IHC) staining of mouse skeletal muscle tissue using MCT4 Recombinant antibody (84797-4-RR)

    IHC staining of mouse skeletal muscle using 84797-4-RR

    Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 84797-4-RR (MCT4 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  • Immunohistochemistry (IHC) staining of mouse skeletal muscle tissue using MCT4 Recombinant antibody (84797-4-RR)

    IHC staining of mouse skeletal muscle using 84797-4-RR

    Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 84797-4-RR (MCT4 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  • Immunofluorescence (IF) / fluorescent staining of mouse skeletal muscle tissue using MCT4 Recombinant antibody (84797-4-RR)

    IF Staining of mouse skeletal muscle using 84797-4-RR

    Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse skeletal muscle tissue using MCT4 antibody (84797-4-RR, Clone: 242296E3 ) at dilution of 1:500 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  • Immunofluorescence (IF) / fluorescent staining of mouse skeletal muscle tissue using MCT4 Recombinant antibody (84797-4-RR)

    IF Staining of mouse skeletal muscle using 84797-4-RR

    Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse skeletal muscle tissue using MCT4 antibody (84797-4-RR, Clone: 242296E3 ) at dilution of 1:500 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  • Immunofluorescence (IF) / fluorescent staining of rat skeletal muscle tissue using MCT4 Recombinant monoclonal antibody (84797-4-RR)

    IF Staining of rat skeletal muscle using 84797-4-RR

    Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded rat skeletal muscle tissue using MCT4 antibody (84797-4-RR, Clone: 242296E3 ) at dilution of 1:500 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  • Immunofluorescence (IF) / fluorescent staining of rat skeletal muscle tissue using MCT4 Recombinant monoclonal antibody (84797-4-RR)

    IF Staining of rat skeletal muscle using 84797-4-RR

    Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded rat skeletal muscle tissue using MCT4 antibody (84797-4-RR, Clone: 242296E3 ) at dilution of 1:500 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  • Immunofluorescence (IF) / fluorescent staining of HepG2 cells using MCT4 Recombinant monoclonal antibody (84797-4-RR)

    IF Staining of HepG2 using 84797-4-RR

    Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using MCT4 antibody (84797-4-RR, Clone: 242296E3 ) at dilution of 1:1000 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

  • Affinity and Kinetic Characterization of 84797-4-RR

    Affinity and Kinetic Characterization of 84797-4-RR

    Biolayer interferometry (BLl) kinetic assays of 84797-4-RR against Human MCT4 were performed. The affinity constant is 3.02 nM.

MCT4 Recombinant monoclonal antibody

MCT4 Uni-rAb® Recombinant Antibody for WB, IHC, IF/ICC, IF-P, ELISA
Cat No. 84797-4-RR
Clone No.242296E3

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IF-P, ELISA

Synonyms

MCT-4, SLC16A3, 242296E3, MCT 4, MCT3

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Please visit your regions distributor:

Tested Applications

Positive WB detected inHeLa cells, HepG2 cells, PC-3 cells
Positive IHC detected inmouse skeletal muscle tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inmouse skeletal muscle tissue, rat skeletal muscle tissue
Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunohistochemistry (IHC)IHC : 1:500-1:2000
Immunofluorescence (IF)-PIF-P : 1:250-1:1000
Immunofluorescence (IF)/ICCIF/ICC : 1:500-1:2000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

84797-4-RR targets MCT4 in WB, IHC, IF/ICC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag18788

Product name: Recombinant human SLC16A3 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 402-465 aa of BC112269

Sequence: LLLGNFFCIRKKPKEPQPEVAAAEEEKLHKPPADSGVDLREVEHFLKAEPEKNGEVVHTPETSV

Predict reactive species
Full Name solute carrier family 16, member 3 (monocarboxylic acid transporter 4)
Calculated Molecular Weight 465 aa, 49 kDa
Observed Molecular Weight 38-42 kDa
GenBank Accession NumberBC112269
Gene Symbol MCT4
Gene ID (NCBI) 9123
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purfication
UNIPROT IDO15427
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The monocarboxylate transporter 4 (MCT4, also known as SLC16A3) is involved in the transportation of metabolically important monocarboxylates such as lactate, pyruvate, acetate and ketone bodies. It is widely expressed, particularly strongly in glycolytic tissues such as white skeletal muscle fibres, astrocytes, white blood cells, chondrocytes and some mammalian cell lines. MCT4 is also linked to tumor biology because it mediates lactate transport across membranes resulting in antiapoptotic effects.

Protocols

Product Specific Protocols
IF protocol for MCT4 antibody 84797-4-RRDownload protocol
IHC protocol for MCT4 antibody 84797-4-RRDownload protocol
WB protocol for MCT4 antibody 84797-4-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
||
New chat Able
正在加载，请稍候...