Use Able AI chat for product recommendations

PDE10A Recombinant monoclonal antibody, PBS Only (Detector)

PDE10A Uni-rAb® Recombinant Antibody for WB, FC (Intra), Cytometric bead array, Sandwich ELISA, Indirect ELISA

Cat No. 84869-1-PBS
Clone No.242357E12

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, FC (Intra), Cytometric bead array, Sandwich ELISA, Indirect ELISA

242357E12, cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A, EC:3.1.4.17, HSPDE10A, phosphodiesterase 10A

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

84869-1-PBS targets PDE10A as part of a matched antibody pair:

MP01645-2: 84869-2-PBS capture and 84869-1-PBS detection (validated in Cytometric bead array, Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag12771

Product name: Recombinant human PDE10A protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 434-779 aa of BC104860

Sequence: KLSYHSICTSEEWQGLMQFTLPVRLCKEIELFHFDIGPFENMWPGIFVYMVHRSCGTSCFELEKLCRFIMSVKKNYRRVPYHNWKHAVTVAHCMYAILQNNHTLFTDLERKGLLIACLCHDLDHRGFSNSYLQKFDHPLAALYSTSTMEQHHFSQTVSILQLEGHNIFSTLSSSEYEQVLEIIRKAIIATDLALYFGNRKQLEEMYQTGSLNLNNQSHRDRVIGLMMTACDLCSVTKLWPVTKLTANDIYAEFWAEGDEMKKLGIQPIPMMDRDKKDEVPQGQLGFYNAVAIPCYTTLTQILPPTEPLLKACRDNLSQWEKVIRGEETATWISSPSVAQKAAASED

Predict reactive species
Full Name phosphodiesterase 10A
Calculated Molecular Weight 779 aa, 88 kDa
Observed Molecular Weight80 kDa
GenBank Accession NumberBC104860
Gene Symbol PDE10A
Gene ID (NCBI) 10846
RRIDAB_3743794
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9Y233
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

PDE10A (Phosphodiesterase 10A) is a single member of the PDE10 protein family, and it catalyzes both cAMP and cGMP hydrolysis (PMID: 34550322). The literature on PDE10A has been focused on psychiatric and neurological disorders because PDE10A expression is enriched in the striatal region of the brain under normal conditions (PMID: 12967715). Moreover, PDE10A expression is induced in various human tumor cell lines and PDE10A inhibition suppresses tumor cell growth (PMID: 37232184).

Loading...
||
New chat

Able

正在加载,请稍候...