PDE10A Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• PDE10A Recombinant monoclonal antibody (84869-1-RR)

• 

  WB analysis using 84869-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 84869-1-RR (PDE10A antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  FC experiment of HeLa using 84869-1-RR

  1x10^6 HeLa cells were intracellularly stained with 0.25 ug PDE10A Recombinant antibody (84869-1-RR, Clone:242357E12) and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.25 ug Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

• 

  Affinity and Kinetic Characterization of 84869-1-RR

  Biolayer interferometry (BLl) kinetic assays of 84869-1-RR against Human PDE10A were performed. The affinity constant is 3.37 nM.

PDE10A Uni-rAb^® Recombinant Antibody for WB, FC (Intra), ELISA

Cat No. 84869-1-RR

Clone No.242357E12

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, FC (Intra), ELISA

Synonyms

242357E12, cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A, EC:3.1.4.17, HSPDE10A, phosphodiesterase 10A

---

Tested Applications

• Positive WB detected in: mouse brain tissue, rat brain tissue
• Positive FC (Intra) detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

84869-1-RR targets PDE10A in WB, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag12771

  Product name: Recombinant human PDE10A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 434-779 aa of BC104860

  Sequence: KLSYHSICTSEEWQGLMQFTLPVRLCKEIELFHFDIGPFENMWPGIFVYMVHRSCGTSCFELEKLCRFIMSVKKNYRRVPYHNWKHAVTVAHCMYAILQNNHTLFTDLERKGLLIACLCHDLDHRGFSNSYLQKFDHPLAALYSTSTMEQHHFSQTVSILQLEGHNIFSTLSSSEYEQVLEIIRKAIIATDLALYFGNRKQLEEMYQTGSLNLNNQSHRDRVIGLMMTACDLCSVTKLWPVTKLTANDIYAEFWAEGDEMKKLGIQPIPMMDRDKKDEVPQGQLGFYNAVAIPCYTTLTQILPPTEPLLKACRDNLSQWEKVIRGEETATWISSPSVAQKAAASED

• Full Name: phosphodiesterase 10A
• Calculated Molecular Weight: 779 aa, 88 kDa
• Observed Molecular Weight: 80 kDa
• GenBank Accession Number: BC104860
• Gene Symbol: PDE10A
• Gene ID (NCBI): 10846
• RRID: AB_3743794
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9Y233
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PDE10A (Phosphodiesterase 10A) is a single member of the PDE10 protein family, and it catalyzes both cAMP and cGMP hydrolysis (PMID: 34550322). The literature on PDE10A has been focused on psychiatric and neurological disorders because PDE10A expression is enriched in the striatal region of the brain under normal conditions (PMID: 12967715). Moreover, PDE10A expression is induced in various human tumor cell lines and PDE10A inhibition suppresses tumor cell growth (PMID: 37232184).